KEGG   Belliella baltica: Belba_3266Help
Entry
Belba_3266        CDS       T02134                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bbd  Belliella baltica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Belba_3266
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Belba_3266
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Belba_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3522559..3524466)
Genome map
AA seq 635 aa AA seqDB search
MNSIKFIKLICLTLVLLSSHLVNAQIPKELALVPYPKEVELGSGSFILQDKVQLFAKNDS
QRGSAMLFNSYINKRFGIRTYISAQAQDYTKIKVSHDSDMEEEAYHLSVKNNQIEIKGGD
AGIFYAFQTLIQLIEPKGNELHIPVVEIKDKPEFGYRGLMIDVSRHFRTLEEMKQVVDLM
AHFKLNKLHWHLTDDQGWRLEIKKYPKLTQVAAWRDSTIIGQYGNYKPFIYDGIKHGGFY
TQDEARELVRYAAERKITVIPEIELPGHSSAVLAAYPEFGSFDVVNGVPIKGLIEAKREN
GNSLNNEISTFVPGYWGIHYNIFGPKEETFKFLEDVLTEVMEIFPSEYIHIGGDEVPKDH
WKTSEIAQSVIKKNKLKDEHELQSYFIKRIEKFLNKNGRNLIGWDEILEGGLAPNATVMS
WRGEAGGIAAAKMGHDVIMTPNSHMYIDHGQGKQADEPLFICCYLPLEKVYSYHPRPMDL
TQDQQKHILGVQANMWTEYVPSFEKMQYMIFPRLLALSEVAWMPQEEKDFSNFAKVRMPK
QLAELDQQKINFRIPEALVEVTLKDGKKEVKLHSSVAGSKIYYTFDGHKADRTAHLYRGP
FFMPVNGEGQEPLKLRYIIVTPSNRESGMYTVDVE
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaattaaatttataaagctaatctgccttactttagtattgctaagcagtcat
ttagttaatgcacaaattcccaaagaacttgctttagtgccttatccaaaagaagtagaa
ttaggttcaggttcatttatcttacaagataaggtgcaactatttgccaagaatgattcg
cagagaggttctgctatgctattcaattcttatatcaacaagaggtttggaataaggacc
tatatttctgctcaagctcaggattatactaaaataaaagttagtcacgattctgacatg
gaggaagaggcctatcatctttctgtaaaaaataatcagattgagattaaagggggtgat
gctggaattttttatgcttttcagactctgattcagcttattgagccaaagggaaatgaa
ttgcatattcctgttgtagagatcaaagataagccagagtttggctacagaggtttgatg
attgatgtcagcaggcattttagaactttggaagaaatgaaacaggtagtcgatttgatg
gcacatttcaaattaaataagcttcattggcatcttactgacgatcaaggttggagatta
gaaatcaaaaagtaccccaaactaacacaagtagctgcctggagggattctactattatt
ggtcaatatggcaattacaagccatttatttatgatggcattaagcatggtggtttttat
actcaagatgaagccagagaactagtacgctatgcagctgaaagaaagatcactgtcatt
cctgaaatcgagcttccaggacatagttctgcggtcttagctgcatatccagaatttgga
agttttgatgttgtcaatggtgttcctatcaaaggattgattgaggcaaagcgtgaaaat
ggaaattcattaaataatgaaatatctacatttgttccaggatactgggggattcattat
aatattttcggtcccaaagaagaaacttttaaatttcttgaagatgttttgacagaggtg
atggagatttttccaagtgaatatattcatattggtggagatgaagttcctaaggatcat
tggaaaacatcggagatagctcaaagtgtgatcaagaaaaataagcttaaggatgaacac
gagttacagagttactttatcaaaagaattgaaaaatttctgaataaaaatggaagaaac
ttaatcggatgggatgaaattctcgaaggaggtctagcaccaaatgcaacagtgatgagt
tggagaggtgaagcaggagggattgcagcggccaagatgggacatgatgttatcatgact
cctaatagtcatatgtacattgaccatggtcagggaaagcaagccgatgaacctttgttt
atttgttgctatttgccattggaaaaggtctatagctatcatccaagaccaatggatctg
actcaagatcagcaaaagcatattttaggagtacaagcaaatatgtggacagagtatgtt
ccatcatttgaaaagatgcaatatatgattttccctaggctacttgctttatcagaagtg
gcctggatgcctcaagaggaaaaagatttcagcaacttcgctaaagttagaatgccaaag
cagttggccgaactcgatcagcaaaaaatcaactttagaattccagaagctcttgtagaa
gttacccttaaagatggaaagaaagaggtcaagctccatagtagtgttgctgggagtaag
atttattacactttcgatggacataaggctgatagaacagcccatctttacagagggcct
tttttcatgccggtgaatggggaagggcaagagccattgaaattgaggtatattattgtg
acaccttcaaatagagaaagtggtatgtatactgtagatgttgagtaa

DBGET integrated database retrieval system