KEGG   Belliella baltica: Belba_3340Help
Entry
Belba_3340        CDS       T02134                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_3340
   01230 Biosynthesis of amino acids
    Belba_3340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_3340
   00030 Pentose phosphate pathway
    Belba_3340
   00051 Fructose and mannose metabolism
    Belba_3340
   00052 Galactose metabolism
    Belba_3340
  Energy metabolism
   00680 Methane metabolism
    Belba_3340
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Belba_3340
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Belba_3340
Protein phosphatases and associated proteins [BR:bbd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Belba_3340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3600622..3601608
Genome map
AA seq 328 aa AA seqDB search
MEPKTIKKIGVLTSGGDAPGMNAAIRATVRAGFFYNLEMYGIYRGYEGMINNEIKKLESK
NIAHILERGGTFLKSARSAEFRTSEGRKKAYENLQKHGIDALVVIGGDGSLTGAHLFFQE
FGIPAIGLPGTIDNDLSGTDSTIGFDTACNTAIQAIDKIRDTATSHDRLFFVEVMGRDAG
FIAINAGIGSAAAATLIPEKKMPIERLVERLKARTKALKQSNIVIVAEGGKSGGAAEIAT
KIKKLLPYYDIKVTILGHLQRGGSPSSFDRVLASKLGVAAVEGLMQGKYDVMAGVINNKI
VFTPITKAIVDDKEVDEDDFRIAKILST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaaaaacaataaaaaaaataggtgtattaacttcaggaggagatgctcctggg
atgaatgcagccataagagctaccgtgagagcaggattcttttataacttagaaatgtac
ggaatatacagaggttatgaaggaatgattaataatgagatcaaaaaacttgaaagtaaa
aatattgctcacattttggaacgtggcggtacatttctcaaatcagcaagaagtgcagaa
ttcagaacttctgaaggaagaaaaaaagcctatgaaaaccttcaaaaacatggcatcgat
gctttggtggttataggaggagatggctctttgacaggagctcatttgttttttcaagaa
tttggaattcctgcaatcggacttccgggtactatagacaatgatttgtcaggtacagac
agtacaattggctttgatacagcttgtaatacagccattcaagcaattgataaaattaga
gatactgctacttctcatgatagacttttctttgtagaagtaatgggaagagatgcaggc
tttattgctatcaatgccggaattggaagtgcggcggcagcaactttgattccagagaag
aaaatgcccattgaaaggctagtagaaaggctaaaagctaggacaaaagcattaaaacaa
tctaatatcgtgattgtagctgaaggaggtaaaagtggtggagcagctgaaatagctaca
aaaatcaaaaagctacttccttattacgatatcaaggtcacaattttagggcatttgcaa
cgcggtggttcaccaagctcatttgacagagtccttgcaagcaaacttggagtagcagcc
gtagagggtctaatgcaaggtaaatatgatgtgatggcaggagtaattaacaataagatt
gtctttactcctattaccaaagctatagtcgatgacaaagaagtagatgaagatgatttt
cgaattgcaaaaatactttcaacctaa

DBGET integrated database retrieval system