KEGG   Belliella baltica: Belba_3374Help
Entry
Belba_3374        CDS       T02134                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_3374
   01230 Biosynthesis of amino acids
    Belba_3374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_3374
   00030 Pentose phosphate pathway
    Belba_3374
   00051 Fructose and mannose metabolism
    Belba_3374
   00052 Galactose metabolism
    Belba_3374
  Energy metabolism
   00680 Methane metabolism
    Belba_3374
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Belba_3374
Protein phosphatases and associated proteins [BR:bbd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Belba_3374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3640602..3641576
Genome map
AA seq 324 aa AA seqDB search
MKKIAVFTSGGDAPGMNACIRAVVRTAIFHGLEVYGITYGYDGMISGNIKKMQSHSVSNI
IQRGGTILKSARSEEFMTKEGRKKAYEQLKALEIDGIVAIGGDGTFTGAKIFFEEFGIPT
VGCPGTIDNDIFGTDYTIGFDTAVNTALEAIDKIRDTAAAHDRIFFVEVMGRDSGYIAVE
CGIGGGAEFVMVPETETDLKKVVKSLKNLRKSKSSSIIVVAEGDDEGNAEVIMDQVKKKV
NDEDKEFKVTTLGHIQRGGNPTARDRVLASRCGMAAVEGLMNGQSNCMAGIVNGDVTYTS
FEDCIGKTKPIKSDHLKLIEILSI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagtttttacttccggaggcgatgcgccgggcatgaatgcttgtatc
agggctgtagtacgcacagcaatttttcacggattagaagtttatggaatcacatatgga
tatgatggtatgatttcaggaaatataaaaaaaatgcaatcacattctgtcagtaatatc
atccaaagggggggcactattttgaaatctgcgagaagtgaggaattcatgaccaaagag
ggaagaaaaaaagcctatgaacaactaaaagctctagaaattgatgggattgtggccatt
ggtggagacggtacttttacaggtgcaaaaatattctttgaagaatttggcatccctact
gttggatgtccagggactattgataatgatatttttggtacagattatactattggtttc
gatactgctgtaaataccgccttagaagcgatagataaaattagagataccgcagctgct
catgacagaatattctttgtagaagtaatgggaagggatagcggatacatagcagttgaa
tgcggaattggtggcggcgcagagtttgtgatggtacctgaaactgaaacagaccttaag
aaggttgtgaaatcattaaaaaaccttagaaaatcaaaatcatctagcatcatcgtcgta
gctgagggagatgatgaaggaaatgctgaagtaatcatggatcaagtaaagaaaaaagtc
aatgatgaggataaagaatttaaagttacaacccttggtcatattcaaagaggaggaaac
ccaacagcaagagatcgcgtcttagcttctcgatgcggtatggctgctgtagaggggttg
atgaatggtcaatccaattgcatggctggaattgtaaatggtgatgtaacctatacttca
tttgaagattgtataggtaaaactaaaccaatcaaaagtgatcatcttaaattaattgaa
attttaagtatttaa

DBGET integrated database retrieval system