KEGG   Belliella baltica: Belba_3405Help
Entry
Belba_3405        CDS       T02134                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbd  Belliella baltica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Belba_3405
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Belba_3405
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Belba_3405
Enzymes [BR:bbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Belba_3405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3673275..3674048)
Genome map
AA seq 257 aa AA seqDB search
MNRIHTLFQNKKERVLSIYFTAGFPTLEDTLPTMRAIEEAGADIIEIGVPYSDPIADGPT
IQDSNQIALENGMSLKKLFDQIKDMRQSVNIPVVLMGYLNPIIQYGMEPFLKKCKEVGVD
GLILPDLPMQQYLDEFKSIFDQYGLSNTFLISPQTSEARIREIDENSNGFIYMVSSHSIT
GAKSGISGEQVEYFKRVQAMNLKNPRLIGFGISDSETFTKASLYGNGAIIGSAFIKVVKD
SKNLSADIKSYIQSVIQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaattcatacactatttcaaaataaaaaagagcgagtattgtctatctatttc
acagctggatttcctacattggaagatactttgccaacgatgcgagcgatagaagaagca
ggagcagatatcatcgaaattggtgtgccttattctgaccctattgctgatggaccaaca
attcaagatagcaatcagattgcattagaaaacggtatgagcttaaaaaagctcttcgat
caaatcaaagatatgcgtcaatcggtcaatattccggtggtgctaatgggttatttgaat
cccattattcaatatggaatggagccatttttaaaaaaatgtaaggaagtgggcgtagat
ggattgatcttgcctgatctacccatgcagcaatatttggatgagttcaaaagtatattt
gatcaatatggtttgagcaatacgtttttgatttctccacaaactagtgaagctagaatc
cgagaaatcgatgaaaattccaatggatttatctacatggtttcttctcacagtatcacg
ggagcaaaatctgggatctcaggagagcaagtagaatacttcaaacgtgttcaagcaatg
aatctcaaaaacccaagattgattggttttgggatttccgattcagaaactttcacaaaa
gcttctctttacggaaacggcgcgattatcggaagtgcattcatcaaagtagtaaaagac
agtaaaaacttatctgctgatattaaatcttatattcagtcagtaattcaataa

DBGET integrated database retrieval system