KEGG   Belliella baltica: Belba_3434Help
Entry
Belba_3434        CDS       T02134                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bbd  Belliella baltica
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Belba_3434
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Belba_3434
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Belba_3434
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Belba_3434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3705295..3706377
Genome map
AA seq 360 aa AA seqDB search
MNSLQYCVIKIGSNVLTQEDGNPDLSRIQHLVFQITFLRQQQIKVILVSSGAVAFGKKEI
QLPEKLNPILKKQIWSSTGQIELIQTYKMLFKEHGIQVSQILVTKEDFRDRKHFLNMKNC
IQGLVSQDILPIINENDSVAITELMFTDNDELASLTAAMVNADSLVLLTNVNGIYTGVPE
EKGSKLIKYVGRETNDLSSFISASKSSFGRGGMLTKLNMAKKSADLGIQVFIANGKKTNI
LEDIFLKKGEYTFFEPNRSKQSTKKWLAHGERYFVAEIIINEGAKTTLFNQKIASLLPVG
IIMISGEFKKGDILCIKDNSGNLIGLGRAEYNSIVAKEKIGLKNQKPIIHYDYLYLIHHD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattgcaatattgtgtaataaagataggctctaatgtactaactcaagaggat
ggaaatccagatttatctagaattcagcatctcgttttccaaattacttttcttcgtcaa
caacaaatcaaagttattttagtcagttccggtgctgttgcatttggaaaaaaagaaatt
cagcttcctgaaaagttaaatccaattctaaaaaagcaaatttggtcatcaactggacaa
attgagcttattcaaacttataaaatgttgtttaaagagcatggaattcaagtttcacaa
atcttggtgactaaagaagattttagggatcggaagcattttctcaatatgaaaaactgt
attcaaggtctagtttcacaagatatcctaccaattataaacgaaaatgattcagtcgcc
atcacggaattgatgtttaccgacaatgatgaattagctagtttaacagccgctatggtc
aacgccgactccctcgtcctactcaccaacgtaaatggaatctacacaggagtaccagaa
gaaaaaggctctaaactgatcaagtatgttgggcgagaaacaaatgatttatcatctttc
atttctgcctcaaaatcctcatttggcagaggcggaatgttgacaaagctcaacatggct
aaaaaatcagcagatttaggtattcaggttttcattgcaaatggcaaaaaaacaaatatc
ctagaagatatttttttaaaaaagggagagtacaccttttttgaaccaaacaggtcaaaa
caaagtaccaaaaaatggctcgcacatggtgagcgatattttgttgcagaaatcatcatc
aatgaaggtgcgaaaacaacgctatttaatcaaaaaatagccagccttcttccagttgga
attataatgatatctggagaatttaaaaaaggtgacatcctttgcataaaagacaattca
ggaaatttgattggactgggtcgtgctgaatacaattcaatcgtagcaaaagaaaaaata
ggactgaaaaaccaaaagccaatcatccattacgactacctttatttaattcatcatgac
tga

DBGET integrated database retrieval system