KEGG   Belliella baltica: Belba_3434Help
Entry
Belba_3434        CDS       T02134                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bbd  Belliella baltica
Pathway
bbd00330  Arginine and proline metabolism
bbd00332  Carbapenem biosynthesis
bbd01100  Metabolic pathways
bbd01130  Biosynthesis of antibiotics
bbd01230  Biosynthesis of amino acids
Module
bbd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Belba_3434
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Belba_3434
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Belba_3434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA RRF_GI
Motif
Other DBs
NCBI-ProteinID: AFL85936
UniProt: I3Z9L8
Position
3705295..3706377
Genome map
AA seq 360 aa AA seqDB search
MNSLQYCVIKIGSNVLTQEDGNPDLSRIQHLVFQITFLRQQQIKVILVSSGAVAFGKKEI
QLPEKLNPILKKQIWSSTGQIELIQTYKMLFKEHGIQVSQILVTKEDFRDRKHFLNMKNC
IQGLVSQDILPIINENDSVAITELMFTDNDELASLTAAMVNADSLVLLTNVNGIYTGVPE
EKGSKLIKYVGRETNDLSSFISASKSSFGRGGMLTKLNMAKKSADLGIQVFIANGKKTNI
LEDIFLKKGEYTFFEPNRSKQSTKKWLAHGERYFVAEIIINEGAKTTLFNQKIASLLPVG
IIMISGEFKKGDILCIKDNSGNLIGLGRAEYNSIVAKEKIGLKNQKPIIHYDYLYLIHHD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattgcaatattgtgtaataaagataggctctaatgtactaactcaagaggat
ggaaatccagatttatctagaattcagcatctcgttttccaaattacttttcttcgtcaa
caacaaatcaaagttattttagtcagttccggtgctgttgcatttggaaaaaaagaaatt
cagcttcctgaaaagttaaatccaattctaaaaaagcaaatttggtcatcaactggacaa
attgagcttattcaaacttataaaatgttgtttaaagagcatggaattcaagtttcacaa
atcttggtgactaaagaagattttagggatcggaagcattttctcaatatgaaaaactgt
attcaaggtctagtttcacaagatatcctaccaattataaacgaaaatgattcagtcgcc
atcacggaattgatgtttaccgacaatgatgaattagctagtttaacagccgctatggtc
aacgccgactccctcgtcctactcaccaacgtaaatggaatctacacaggagtaccagaa
gaaaaaggctctaaactgatcaagtatgttgggcgagaaacaaatgatttatcatctttc
atttctgcctcaaaatcctcatttggcagaggcggaatgttgacaaagctcaacatggct
aaaaaatcagcagatttaggtattcaggttttcattgcaaatggcaaaaaaacaaatatc
ctagaagatatttttttaaaaaagggagagtacaccttttttgaaccaaacaggtcaaaa
caaagtaccaaaaaatggctcgcacatggtgagcgatattttgttgcagaaatcatcatc
aatgaaggtgcgaaaacaacgctatttaatcaaaaaatagccagccttcttccagttgga
attataatgatatctggagaatttaaaaaaggtgacatcctttgcataaaagacaattca
ggaaatttgattggactgggtcgtgctgaatacaattcaatcgtagcaaaagaaaaaata
ggactgaaaaaccaaaagccaatcatccattacgactacctttatttaattcatcatgac
tga

DBGET integrated database retrieval system