KEGG   Belliella baltica: Belba_3555Help
Entry
Belba_3555        CDS       T02134                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbd  Belliella baltica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bbd01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbd00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bbd00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3844344..3845654
Genome map
AA seq 436 aa AA seqDB search
MATVEMIMPKMGESIIEGTILTWLKKEGDTIEQDESVLEVATDKVDTEVPATQGGILKQI
LVKEGDVVAVGAPIAIIETEGEVSNEQSKSPAKEESSPKEALIAAAPAQTATLVSENSKN
EPVSGDDRFYSPLVQSIAKEENISKSELSSISGTGKDGRVTKNDILGYIKNRNQPKPTDS
ISNAKPSASAPMPKAEVSISASDEIIEMDRMRKMIAQRMLDSKRISPHVTSFVEADVTNI
VLWRNKVKDAYKKKEGEALTFTPFFVQAVARAIRDFPMINISVDGDKIIKKKDINIGIAV
ALPSGNLIVPNIKNADQFNLTGLSKKVNDLALRARNNKLSPDELGGGTYTISNVGSFGNV
MGTPIIMQPQVAILAVGAITKKPAVVETPTGDVIAIRHKMFLSHSYDHRVVDGSLGGMFV
KRVADYLEEFNLDTEL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtagaaatgataatgcccaaaatgggtgaaagcattatagagggaaccatc
ctaacttggcttaaaaaagaaggtgatacaatagagcaagatgaatctgttctagaagtt
gctacagataaagttgacacggaagttcctgctacccaaggtgggattttaaaacaaatt
ttggtaaaagaaggagatgtagtggctgtaggcgcaccaattgcaatcatcgaaactgaa
ggtgaggtctccaacgaacaaagtaaaagtccagcaaaagaagaatcttctccaaaagaa
gcattgattgctgccgctccagctcaaactgccactcttgtatcagaaaattcaaaaaat
gaacctgtgtcaggtgatgatagattctactcgcctctggttcagagtattgccaaagaa
gagaatatttcaaaatcagagctttcttctatatcaggaacaggtaaggatgggagagtt
actaaaaatgatattctaggatatattaaaaatagaaatcagcctaaaccaacggattcc
atttccaacgcaaaaccttctgcaagcgcaccaatgccgaaagcagaggtgagtatctct
gcaagtgatgaaatcatagaaatggacagaatgcgtaagatgattgcgcaaagaatgtta
gattctaaaagaatttcacctcatgtgacttcatttgttgaagcagatgtgactaatatt
gtgctttggagaaataaggtaaaagatgcctataagaaaaaggaaggtgaagcattaaca
tttactccgttttttgttcaagctgttgcaagagcgatcagagattttccaatgattaat
atttctgtggacggagacaaaattatcaagaaaaaagacatcaatattggcattgctgta
gccttaccaagtggcaatttgattgtcccaaatattaaaaatgctgatcaatttaactta
actggactttccaaaaaagttaatgatttggctttgagagcaagaaataacaagctttca
cctgatgaacttggtggtggaacttatacaatttcgaatgtaggttcttttggaaatgtg
atgggaacaccaattatcatgcaaccacaagttgcaatacttgcagttggggcaattacg
aaaaaacccgctgtcgtagaaacaccaacgggagacgtaattgcaattaggcacaaaatg
ttcctttctcattcttatgaccatcgtgtcgtggatggctcacttggaggaatgtttgtc
aaaagagtagctgattatctcgaagagtttaatttagatacagaattataa

DBGET integrated database retrieval system