KEGG   Belliella baltica: Belba_3555Help
Entry
Belba_3555        CDS       T02134                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbd  Belliella baltica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_3555
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Belba_3555
  Amino acid metabolism
   00310 Lysine degradation
    Belba_3555
Enzymes [BR:bbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Belba_3555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3844344..3845654
Genome map
AA seq 436 aa AA seqDB search
MATVEMIMPKMGESIIEGTILTWLKKEGDTIEQDESVLEVATDKVDTEVPATQGGILKQI
LVKEGDVVAVGAPIAIIETEGEVSNEQSKSPAKEESSPKEALIAAAPAQTATLVSENSKN
EPVSGDDRFYSPLVQSIAKEENISKSELSSISGTGKDGRVTKNDILGYIKNRNQPKPTDS
ISNAKPSASAPMPKAEVSISASDEIIEMDRMRKMIAQRMLDSKRISPHVTSFVEADVTNI
VLWRNKVKDAYKKKEGEALTFTPFFVQAVARAIRDFPMINISVDGDKIIKKKDINIGIAV
ALPSGNLIVPNIKNADQFNLTGLSKKVNDLALRARNNKLSPDELGGGTYTISNVGSFGNV
MGTPIIMQPQVAILAVGAITKKPAVVETPTGDVIAIRHKMFLSHSYDHRVVDGSLGGMFV
KRVADYLEEFNLDTEL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtagaaatgataatgcccaaaatgggtgaaagcattatagagggaaccatc
ctaacttggcttaaaaaagaaggtgatacaatagagcaagatgaatctgttctagaagtt
gctacagataaagttgacacggaagttcctgctacccaaggtgggattttaaaacaaatt
ttggtaaaagaaggagatgtagtggctgtaggcgcaccaattgcaatcatcgaaactgaa
ggtgaggtctccaacgaacaaagtaaaagtccagcaaaagaagaatcttctccaaaagaa
gcattgattgctgccgctccagctcaaactgccactcttgtatcagaaaattcaaaaaat
gaacctgtgtcaggtgatgatagattctactcgcctctggttcagagtattgccaaagaa
gagaatatttcaaaatcagagctttcttctatatcaggaacaggtaaggatgggagagtt
actaaaaatgatattctaggatatattaaaaatagaaatcagcctaaaccaacggattcc
atttccaacgcaaaaccttctgcaagcgcaccaatgccgaaagcagaggtgagtatctct
gcaagtgatgaaatcatagaaatggacagaatgcgtaagatgattgcgcaaagaatgtta
gattctaaaagaatttcacctcatgtgacttcatttgttgaagcagatgtgactaatatt
gtgctttggagaaataaggtaaaagatgcctataagaaaaaggaaggtgaagcattaaca
tttactccgttttttgttcaagctgttgcaagagcgatcagagattttccaatgattaat
atttctgtggacggagacaaaattatcaagaaaaaagacatcaatattggcattgctgta
gccttaccaagtggcaatttgattgtcccaaatattaaaaatgctgatcaatttaactta
actggactttccaaaaaagttaatgatttggctttgagagcaagaaataacaagctttca
cctgatgaacttggtggtggaacttatacaatttcgaatgtaggttcttttggaaatgtg
atgggaacaccaattatcatgcaaccacaagttgcaatacttgcagttggggcaattacg
aaaaaacccgctgtcgtagaaacaccaacgggagacgtaattgcaattaggcacaaaatg
ttcctttctcattcttatgaccatcgtgtcgtggatggctcacttggaggaatgtttgtc
aaaagagtagctgattatctcgaagagtttaatttagatacagaattataa

DBGET integrated database retrieval system