KEGG   Brevibacillus brevis: BBR47_00190Help
Entry
BBR47_00190       CDS       T00879                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bbe  Brevibacillus brevis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bbe01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbe00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bbe00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
34158..35765
Genome map
AA seq 535 aa AA seqDB search
MTTVPTNPYPLEVQISGEMHPGYQEILTPEAIQFVMKLEQRFGDRRQQLLAKRVERQLQI
DAGQLPDFLQETADIRKGDWTVAPLPKDLQDRRVEITGPSGDRKMVINALNSGARLFMAD
FEDANSPTWENTIQGQINMKDAVRRNISYISPEGKSYTLNEKTAVLIVRPRGWHLEEKHI
LLDQKPISGSLLDFGLYFYHNVDALIANQTAPYFYLPKLESHLEARLWNDVFLFAQDELN
IPRGTIRATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSYIKKLRNQPDVITPD
RAQVTMTVPFMKAYTTLAVKTCHKRMAPCIGGMAAQIPVKNDPVQNAEAIAKVRADKERE
AYDGHDGTWVAHPGLVPVAMEVFDRLMREPNQIWYKREDVDVSASHLLAVPEGTITEAGV
RTNISVGLQYIEAWLRGSGAVPINNLMEDAATAEISRAQVWQWMRHRHGVLQDGRKVTEG
LVKQWLSEELQAIKQAIGQERYDNSKYTIAGDLFLQLVTTEDFEDFLTVPGYRYL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
ttgactaccgtaccaacgaatccatatccgctggaggtgcagatttccggtgagatgcac
cctggttatcaagaaatcctgacaccagaagcgattcaattcgtgatgaagctggagcaa
aggtttggcgacagacgacaacaattgttggcgaaacgcgtggagcgtcaattgcaaatc
gatgcaggccaactgccggattttctacaggagacagcggacattcgtaaaggagattgg
actgttgctccattgcccaaagatttgcaggacagacgggtggagattacaggaccttcg
ggtgaccgaaaaatggtcatcaatgcactgaactcgggtgctcgacttttcatggctgac
tttgaggacgcgaactcaccgacctgggagaacaccatccaaggccaaatcaacatgaag
gatgcggtacgccgcaatatctcttacatcagtccggagggcaaatcatacaccctcaat
gaaaagacagcggttttgatcgtgcgtcctcgtggctggcatcttgaagaaaagcacatc
ctcctcgatcaaaaaccgatctccggtagcctgcttgatttcggactttacttttaccac
aacgtagatgctcttatcgcgaatcagacagcaccgtatttctacttaccgaaactggaa
agccacttggaggctcgactctggaacgacgtcttccttttcgcgcaggatgaattaaat
attccacgcggtacaattcgggcgacagtattgatcgaaacgattctcgcagcctttgag
atggatgagattctgtatgagctgcgcgagcatagtgcaggactgaattgcggacgttgg
gattacattttcagctatatcaaaaagctgcggaatcagcctgatgtgattacaccggat
cgtgcccaagtaaccatgaccgttccgttcatgaaagcatacacaacgctggccgtgaag
acttgccataaacggatggcaccctgcatcggcggaatggcggcacaaattccggtgaaa
aatgacccggtacaaaatgctgaagccatcgccaaagtgcgcgctgacaaagagcgggaa
gcgtacgatggacatgacgggacttgggttgctcaccctgggctagtgccagtagctatg
gaagtgttcgatcgcctgatgagagagccgaaccaaatctggtacaaacgtgaagacgta
gacgtatctgctagtcacctgctggcagtcccagagggcacgattacagaagcgggtgtc
cgtacgaacataagcgtaggcttgcagtacatcgaggcttggttgcgaggctctggagct
gtgccgatcaacaatctgatggaggatgcggctacagcagaaatttcccgggcacaggtc
tggcaatggatgcgtcatcgtcacggagtcttgcaggatggtagaaaggtgacggaaggc
ttggtgaagcagtggctgagtgaggagctgcaagcgatcaagcaagcaattggccaagag
aggtacgacaacagcaagtatacgattgcaggtgatctgttcttgcaattggtaacgaca
gaagatttcgaagacttcctaacggtaccgggttatcgctatttgtaa

DBGET integrated database retrieval system