KEGG   Brevibacillus brevis: BBR47_00190Help
Entry
BBR47_00190       CDS       T00879                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bbe  Brevibacillus brevis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBR47_00190 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBR47_00190 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BBR47_00190 (aceB)
Enzymes [BR:bbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BBR47_00190 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
34158..35765
Genome map
AA seq 535 aa AA seqDB search
MTTVPTNPYPLEVQISGEMHPGYQEILTPEAIQFVMKLEQRFGDRRQQLLAKRVERQLQI
DAGQLPDFLQETADIRKGDWTVAPLPKDLQDRRVEITGPSGDRKMVINALNSGARLFMAD
FEDANSPTWENTIQGQINMKDAVRRNISYISPEGKSYTLNEKTAVLIVRPRGWHLEEKHI
LLDQKPISGSLLDFGLYFYHNVDALIANQTAPYFYLPKLESHLEARLWNDVFLFAQDELN
IPRGTIRATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSYIKKLRNQPDVITPD
RAQVTMTVPFMKAYTTLAVKTCHKRMAPCIGGMAAQIPVKNDPVQNAEAIAKVRADKERE
AYDGHDGTWVAHPGLVPVAMEVFDRLMREPNQIWYKREDVDVSASHLLAVPEGTITEAGV
RTNISVGLQYIEAWLRGSGAVPINNLMEDAATAEISRAQVWQWMRHRHGVLQDGRKVTEG
LVKQWLSEELQAIKQAIGQERYDNSKYTIAGDLFLQLVTTEDFEDFLTVPGYRYL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
ttgactaccgtaccaacgaatccatatccgctggaggtgcagatttccggtgagatgcac
cctggttatcaagaaatcctgacaccagaagcgattcaattcgtgatgaagctggagcaa
aggtttggcgacagacgacaacaattgttggcgaaacgcgtggagcgtcaattgcaaatc
gatgcaggccaactgccggattttctacaggagacagcggacattcgtaaaggagattgg
actgttgctccattgcccaaagatttgcaggacagacgggtggagattacaggaccttcg
ggtgaccgaaaaatggtcatcaatgcactgaactcgggtgctcgacttttcatggctgac
tttgaggacgcgaactcaccgacctgggagaacaccatccaaggccaaatcaacatgaag
gatgcggtacgccgcaatatctcttacatcagtccggagggcaaatcatacaccctcaat
gaaaagacagcggttttgatcgtgcgtcctcgtggctggcatcttgaagaaaagcacatc
ctcctcgatcaaaaaccgatctccggtagcctgcttgatttcggactttacttttaccac
aacgtagatgctcttatcgcgaatcagacagcaccgtatttctacttaccgaaactggaa
agccacttggaggctcgactctggaacgacgtcttccttttcgcgcaggatgaattaaat
attccacgcggtacaattcgggcgacagtattgatcgaaacgattctcgcagcctttgag
atggatgagattctgtatgagctgcgcgagcatagtgcaggactgaattgcggacgttgg
gattacattttcagctatatcaaaaagctgcggaatcagcctgatgtgattacaccggat
cgtgcccaagtaaccatgaccgttccgttcatgaaagcatacacaacgctggccgtgaag
acttgccataaacggatggcaccctgcatcggcggaatggcggcacaaattccggtgaaa
aatgacccggtacaaaatgctgaagccatcgccaaagtgcgcgctgacaaagagcgggaa
gcgtacgatggacatgacgggacttgggttgctcaccctgggctagtgccagtagctatg
gaagtgttcgatcgcctgatgagagagccgaaccaaatctggtacaaacgtgaagacgta
gacgtatctgctagtcacctgctggcagtcccagagggcacgattacagaagcgggtgtc
cgtacgaacataagcgtaggcttgcagtacatcgaggcttggttgcgaggctctggagct
gtgccgatcaacaatctgatggaggatgcggctacagcagaaatttcccgggcacaggtc
tggcaatggatgcgtcatcgtcacggagtcttgcaggatggtagaaaggtgacggaaggc
ttggtgaagcagtggctgagtgaggagctgcaagcgatcaagcaagcaattggccaagag
aggtacgacaacagcaagtatacgattgcaggtgatctgttcttgcaattggtaacgaca
gaagatttcgaagacttcctaacggtaccgggttatcgctatttgtaa

DBGET integrated database retrieval system