KEGG   Brevibacillus brevis: BBR47_01730Help
Entry
BBR47_01730       CDS       T00879                                 

Definition
alkaline phosphatase precursor (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bbe  Brevibacillus brevis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBR47_01730
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBR47_01730
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBR47_01730
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BBR47_01730
Exosome [BR:bbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBR47_01730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
183193..184554
Genome map
AA seq 453 aa AA seqDB search
MFRTFPKKLVPMAVISSLAFTAFFGPTTGLVKAAENNNNAKVKNVIFLIGDGMGTAYTTA
HRYMKDDPSTPLMEPTEFDKYLVGAQMTYAEDHKQNITDSASAATAMSSGKKTYNNAIAV
DNDKSEVETVLERAKKVGKSTGWVATSEITHATPASYGAHDESRKNMDAIANDYYDLKIN
GEHSIDVMLGGGLKNFVRKDRDLTKEFKKDGYSYVTSKSELLDDKNGKILGLFADGGMDK
MIDRSKETPSLEEMTNAAIDRLSKNKNGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFERA
FKAAIDFAKKDGHTLVIATADHSTGGLSVAAKDEYNFLVAPIKAVKRTPDFISTEIAKGA
NVEETLKKYIDLELTPEEIASVKKATETKDQVKIDNAIEAIIDTRSFTGWTTGGHTGEDV
NVYAYGPGKEKVSGLIDNTKNADVIFEILGGKK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtacattccccaaaaaactcgttccaatggcagtaatctcctcgctggctttt
acagcgttcttcggtcctactacaggtcttgtaaaagcagcagaaaataataacaacgca
aaagtaaaaaatgtaatcttcttgatcggtgacggcatgggtactgcttacacaaccgca
catcgttacatgaaggacgacccttcgactccactgatggagccaacagaattcgataaa
tatttggtcggtgcacaaatgacttatgcagaagaccacaagcaaaacattacagactcc
gcatctgctgctacggcgatgtcttccggtaaaaaaacatacaataatgccattgcggta
gacaacgacaaatcagaagtagaaacggtactcgagcgtgcgaaaaaagtaggtaaatct
actggctgggtagctacctccgaaattacacatgctactccggcttcttatggcgctcat
gacgaaagccgcaagaatatggatgcgattgcgaatgattactatgatttgaaaattaac
ggggagcattctattgacgtaatgcttggcggtggcttgaaaaacttcgtccgtaaagat
cgtgacctgacgaaagagtttaagaaagatggctacagctacgttacttcgaagagcgaa
ctattggacgacaaaaacggcaaaattctcggattgtttgcagatggcggaatggacaaa
atgatcgaccgttccaaggaaacaccttccctggaagaaatgacaaatgctgcgatcgat
cgtctgagcaagaacaagaatgggttcttcctgatggtagaaggaagccaaattgactgg
gctggtcatgataacgatatcgttggcgcaatgagcgagatggaagatttcgagagagct
ttcaaagcagcgattgatttcgcaaagaaagatggccatacgctggttatcgcgactgct
gaccactccacgggtggattgtctgtagcggctaaagatgaatacaacttcttggtagcg
ccaattaaagcagtgaaacgtacgcctgatttcatttcgactgaaatcgcaaaaggtgca
aatgtagaagaaacactcaagaagtacattgaccttgagctgaccccggaagaaatcgcg
tctgtgaaaaaggctactgaaacaaaagaccaagtgaaaattgataatgccatcgaagcg
attatcgatacacgctcttttactggctggacaacaggcggacacacaggtgaggatgta
aacgtctatgcgtatggtcctggtaaagagaaagtatctggtttgatcgacaacaccaaa
aacgcggatgtcattttcgaaatcctgggcgggaaaaaataa

DBGET integrated database retrieval system