KEGG   Brevibacillus brevis: BBR47_01760Help
Entry
BBR47_01760       CDS       T00879                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bbe  Brevibacillus brevis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
186149..186991
Genome map
AA seq 280 aa AA seqDB search
MPAKLRARRELNCGQYVLPLGERTLVMGILNVTPDSFSDGGRYVNVEAALAQARAMVEAG
ADLIDIGGESTRPGSEAVDEATELDRVLPVIRMLSQELSVPLSIDTYKAAVAERAILEGA
HIINDVWGAKRDPRMAEVAARLDVPIILMHNREDTDYHDFFPNYIKDLRESVQIALQAGV
KQERIILDPGIGFVRTVEQNLETMRRLDDLVGLGYPVLLATSRKRMIGHVLDLPVDERVE
GTAATVALGAAKGCHMVRVHDVKEMKRVTKMMDAMLKGGI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaagcttcgtgcgcggcgcgagttgaactgtggccagtatgttctgccactg
ggggagcgtacgctagtcatgggaattttgaatgtgacacctgattctttctcggatggc
ggccgttatgtcaatgtggaggcagcactcgcacaagcgcgtgcaatggttgaggctgga
gctgacctgattgatatcggtggagaatcgacacgtccggggtcggaagcagtcgatgag
gcgacggagctggacagagtgctgccagtcattcggatgctttcgcaggaattgtctgtt
ccgctgtccattgacacgtacaaagcggcggttgcagaacgggctattctggagggggca
catatcatcaatgatgtatggggagcgaagcgtgacccgcggatggcagaggtagctgct
cgtctcgatgtgcccattatcctgatgcacaaccgcgaagacacggactatcacgacttt
ttcccaaactatatcaaagacctgcgtgagtccgtacagatcgccttgcaggcaggggta
aagcaggagagaatcatcctcgatccggggatcgggtttgtaaggactgtcgagcaaaat
ctcgaaacaatgcgcaggctggatgatctggtagggctgggctatcctgttctacttgct
acttcacgcaagcggatgatcggtcatgttctcgacttgcctgtagatgagcgtgtcgaa
ggtacggcagcgacagttgctctcggggcggcaaaaggctgtcatatggtacgggtgcat
gatgtcaaagaaatgaagcgcgttacgaagatgatggacgcgatgctaaaagggggcatt
taa

DBGET integrated database retrieval system