KEGG   Brevibacillus brevis: BBR47_01760Help
Entry
BBR47_01760       CDS       T00879                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00790  Folate biosynthesis
bbe01100  Metabolic pathways
Module
bbe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBR47_01760 (folP)
Enzymes [BR:bbe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BBR47_01760 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: BAH41153
NITE: BBR47_01760
UniProt: C0ZID5
Position
186149..186991
Genome map
AA seq 280 aa AA seqDB search
MPAKLRARRELNCGQYVLPLGERTLVMGILNVTPDSFSDGGRYVNVEAALAQARAMVEAG
ADLIDIGGESTRPGSEAVDEATELDRVLPVIRMLSQELSVPLSIDTYKAAVAERAILEGA
HIINDVWGAKRDPRMAEVAARLDVPIILMHNREDTDYHDFFPNYIKDLRESVQIALQAGV
KQERIILDPGIGFVRTVEQNLETMRRLDDLVGLGYPVLLATSRKRMIGHVLDLPVDERVE
GTAATVALGAAKGCHMVRVHDVKEMKRVTKMMDAMLKGGI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaagcttcgtgcgcggcgcgagttgaactgtggccagtatgttctgccactg
ggggagcgtacgctagtcatgggaattttgaatgtgacacctgattctttctcggatggc
ggccgttatgtcaatgtggaggcagcactcgcacaagcgcgtgcaatggttgaggctgga
gctgacctgattgatatcggtggagaatcgacacgtccggggtcggaagcagtcgatgag
gcgacggagctggacagagtgctgccagtcattcggatgctttcgcaggaattgtctgtt
ccgctgtccattgacacgtacaaagcggcggttgcagaacgggctattctggagggggca
catatcatcaatgatgtatggggagcgaagcgtgacccgcggatggcagaggtagctgct
cgtctcgatgtgcccattatcctgatgcacaaccgcgaagacacggactatcacgacttt
ttcccaaactatatcaaagacctgcgtgagtccgtacagatcgccttgcaggcaggggta
aagcaggagagaatcatcctcgatccggggatcgggtttgtaaggactgtcgagcaaaat
ctcgaaacaatgcgcaggctggatgatctggtagggctgggctatcctgttctacttgct
acttcacgcaagcggatgatcggtcatgttctcgacttgcctgtagatgagcgtgtcgaa
ggtacggcagcgacagttgctctcggggcggcaaaaggctgtcatatggtacgggtgcat
gatgtcaaagaaatgaagcgcgttacgaagatgatggacgcgatgctaaaagggggcatt
taa

DBGET integrated database retrieval system