KEGG   Brevibacillus brevis: BBR47_01780Help
Entry
BBR47_01780       CDS       T00879                                 

Gene name
folK
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00790  Folate biosynthesis
bbe01100  Metabolic pathways
Module
bbe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBR47_01780 (folK)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BBR47_01780 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: BAH41155
NITE: BBR47_01780
UniProt: C0ZID7
Position
187363..187893
Genome map
AA seq 176 aa AA seqDB search
MTVCAYLALGSNLGDRAQNLRRAIQRLNEQPGIRVLRVSSVYETDPFGYVEQDAFLNMAI
AVETEQSPDQLLETALSVERELGRVRTVRWGPRTIDIDLLLYGTSRVSQDNLMIPHPGLS
ERAFVLVPLRDVWEGGVLPEHNQTIDHYLSLLVEDHKGVREWGAINWEIESGPSES
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttgtgcgtatttggcgctaggctccaatctcggggatcgggcacagaacttg
cgccgggcgatacagagattgaacgagcaacctggaattcgcgtgctacgtgtctcctct
gtttatgagaccgatccatttggttacgtcgagcaagatgcatttctaaatatggcgatc
gctgtggaaacagaacagagcccggatcagctgctagagacggctctgtcagtagagcga
gagctaggtcgtgtgcgaacggtacgatggggaccgcgcacaattgatattgacttactg
ttgtacgggacatctcgtgtttcgcaagacaatctcatgattcctcatcccgggctgagc
gagcgtgcttttgtactcgtgccgcttcgagacgtttgggagggcggcgttttacctgag
cataaccagaccattgatcattatctttccttattggtagaagatcacaagggggtacgt
gagtggggagcaatcaactgggaaatcgaatccggtccttccgaaagctaa

DBGET integrated database retrieval system