KEGG   Brevibacillus brevis: BBR47_01960Help
Entry
BBR47_01960       CDS       T00879                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bbe  Brevibacillus brevis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBR47_01960 (gltX)
Enzymes [BR:bbe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BBR47_01960 (gltX)
Amino acid related enzymes [BR:bbe01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BBR47_01960 (gltX)
Transfer RNA biogenesis [BR:bbe03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BBR47_01960 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
210375..211841
Genome map
AA seq 488 aa AA seqDB search
MAKEIRTRYAPSPTGHLHIGGARTALFNYLFAKHHGGSFIVRIEDTDQTRNKENADEEQM
KNLKWLGVTWEEGTDVGGPYGPYRQTERLDIYRKYIDQLLAEGKAYYCYATKEELDAERE
EQLARGETPRILEKHRHVTDEQRAQYEAEGRVPSIHFLVQDDREYVVNDLIRGQVTFNSN
EMGDFVICRPDGIPTYNFAVVVDDYLMKISHVIRGEEHLSNTPRQLMIYEAFGWEAPDFA
HLALILNQDGKKMSKRDESILQFIEQYRDLGFLPEAIVNFLVLLGWSPGGEEEIFLMEDL
IKLFSMDRVNKSPAVFDATKMNWMNNFYLKRQPLDMITDMCIPHLQKAGFIEETLSAEKR
EWVRSIVGLYQEQMSYCAQIVPLAALFFLDEVVYDEEATLVLKEPQLPEVLASFVKHLSA
QDAYNVDVIKAVLKDVQKETGHKGKALFMPVRVGATGQAHGRDLAETLYLLGRDKVIARA
QQVIANGQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaaattcgcactcgttatgcgccgagtcctacggggcatttacacatcggc
ggtgcgcgaacagcgctctttaattatctttttgcgaaacatcacggtggttcgttcatc
gttcggattgaagatacggaccaaacgcgcaataaggaaaatgcggacgaagagcaaatg
aaaaacctgaaatggctcggcgtaacatgggaagaaggtacagacgttgggggaccatat
ggaccgtaccgtcaaacagagcgcctggacatttatcggaaatatatcgatcaactgcta
gcagaaggcaaagcatactactgctacgcgacaaaagaagagctggatgcagaacgtgaa
gaacagctcgcgcgtggagaaacaccacgcattctggaaaagcaccgccatgtaacggac
gagcagcgggctcagtacgaagcagaaggtcgagtgccatccattcacttcctcgttcag
gatgatcgcgaatatgtcgtgaacgacctgattcgcggccaggtaacattcaactccaac
gagatgggcgatttcgttatttgccgtccggatgggattcctacatacaacttcgctgtt
gtagtggacgactatttgatgaaaattagccacgtcattcgtggagaagagcatctgtct
aacacgcctcgtcaattgatgatttacgaagcgtttggatgggaagcgcctgactttgct
cacttggcactgatcctcaaccaagacggcaaaaagatgtccaagcgcgatgagagcatt
cttcagttcattgaacagtaccgtgacctgggcttcttgccagaagcaatcgtgaacttc
cttgttctcttgggatggtctccaggtggcgaagaagagattttcttaatggaagatctg
atcaagctgttctcaatggatcgcgtgaacaagtctccagctgtgtttgatgcaacgaag
atgaactggatgaacaacttttatttgaagcgtcaaccgctggatatgattacagacatg
tgtatcccgcatctgcaaaaagctggcttcatcgaagagactttgtctgctgagaagcgc
gaatgggttcgcagtatcgtaggcctgtaccaagagcaaatgtcctactgtgcgcaaatc
gttccgttggcagcccttttcttcctcgacgaagtggtgtacgatgaagaagcaactctg
gtgctgaaagaaccgcaattgccggaagtacttgcttcctttgtgaaacacctttctgcc
caggatgcatataatgtggatgttattaaagcggtactcaaggacgtgcaaaaggaaacg
ggtcacaaaggcaaggcgttgtttatgccggttcgcgtaggagcaactggccaggcgcat
ggtcgtgatttggcagagacgttgtatctgcttggacgcgacaaggtgattgcacgtgca
caacaagtaattgcaaacggtcagtaa

DBGET integrated database retrieval system