KEGG   Brevibacillus brevis: BBR47_02630Help
Entry
BBR47_02630       CDS       T00879                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00220  Arginine biosynthesis
bbe00330  Arginine and proline metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01130  Biosynthesis of antibiotics
bbe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BBR47_02630 (rocF)
   00330 Arginine and proline metabolism
    BBR47_02630 (rocF)
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BBR47_02630 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAH41240
NITE: BBR47_02630
UniProt: C0ZIM2
Position
266622..267518
Genome map
AA seq 298 aa AA seqDB search
MNKNMSIVGVPMDLGADRRGVDMGPSAIRYAGVVARLEKMGFNIEDRGDIFVTRPHHFTE
TENHKYLDEVVEANEKLANVVSDIMTAGRFPLVLGGDHSIALGTIAGVAKHVKNLGVIWF
DAHGDLNTGATSPSGNIHGMPLAASLGYGHERLTNIGGYTPKVKAENVVIIGARDLDQGE
RELIKRIGMKVFTMHEIDKLGMARVMDEAIAHVSKNTDGVHLSLDLDGLDPHDAPGVGTP
VIGGISYREGHVSLEMLADADILCSAEFVEVNPILDRENMTARVAVALMSSVFGDKLL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaacatgagcattgttggtgtaccgatggatctaggtgcagaccgccgcgga
gtcgatatggggcctagcgcaatccgttatgcaggtgttgtagcacgcctggaaaagatg
ggcttcaatattgaagaccgcggagatatttttgtaacgcgccctcatcacttcaccgag
acggaaaaccataaatacctggatgaagtcgtggaagctaatgaaaagcttgccaatgtt
gtaagcgatatcatgactgctggtcgattcccgctcgtattgggtggagatcacagtatt
gcccttggaaccattgcgggtgtcgctaagcacgtaaaaaacctgggtgtcatttggttt
gacgctcatggtgatttgaatacgggtgccacttctccatcgggaaatattcacggtatg
cctttggcagcgagcttggggtatgggcatgagcgtctgacgaacattgggggatataca
ccaaaggtaaaggcagaaaacgtggtcatcatcggtgcgcgtgatctggatcaaggcgag
cgtgaattgatcaagcgtatcgggatgaaggttttcaccatgcacgaaattgataagttg
ggtatggctcgagtcatggatgaagcaatcgcgcatgtgtccaaaaacacagatggcgtg
catttgagcctcgacttggatggacttgatccacacgatgctccgggagtagggacgcca
gtaataggtggtatctcctatcgtgaagggcatgtctcattggaaatgctggcagatgca
gatattctttgctcggcagaattcgtagaggtcaacccgattcttgaccgagaaaacatg
acagctcgcgttgcagtcgctttgatgagttccgtttttggtgataaattactataa

DBGET integrated database retrieval system