KEGG   Brevibacillus brevis: BBR47_03510Help
Entry
BBR47_03510       CDS       T00879                                 

Gene name
yxjF
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bbe  Brevibacillus brevis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BBR47_03510 (yxjF)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BBR47_03510 (yxjF)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BBR47_03510 (yxjF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
352165..352950
Genome map
AA seq 261 aa AA seqDB search
MEKLLEQQVAVVTGAASGIGLEIARTFAEEGARVVILDLNGEAAEAAAAQLQKEGHEAIS
FGCNVTDEVQMQACIQQTVQIFGRLDILVNNAGLQFVSPIEEFPTAKFEQMLSIMLTAPF
VAIKHVFPIMKQQGHGRIINMASINGLIGFAGKAAYNSAKHGVIGLTKVAALEGAAAGIT
VNAICPGYVDTPLVQNQLADLAKTRNVPLEKVMEEVIYPLVPQKRLLQVKEVANYAAFLA
SKKASGVTGQAVVIDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggagaagttgttggagcaacaggtagcagttgtaacaggggctgcaagcggtattgga
ttggagattgcccggacgtttgccgaggaaggggcgagggtcgtcatactggacttgaat
ggggaagcagcggaagcagcagcagcccaattgcagaaggaaggtcacgaagcaatcagc
tttggttgtaatgttactgacgaggtacaaatgcaggcgtgcatccagcagacagtccaa
atttttggcagactcgatatcctagtgaataatgccggattgcaatttgtttctcctata
gaagagtttccgactgcaaaatttgaacaaatgctcagtattatgctgacagcgcctttt
gtcgcgattaaacacgtgttccccattatgaagcaacaaggccatggccgtatcatcaat
atggcttcgatcaacggcttgattggctttgcagggaaggcagcttacaacagtgccaag
cacggagtcatcgggctcaccaaggttgcagccttggaaggagcagcggctggtattacg
gtaaatgccatttgtccggggtatgtcgatacgccgctggtacaaaaccaattagcggat
ttggctaagacaagaaatgtgccgttggaaaaggtgatggaagaagtcatctacccgctg
gtgccgcagaagcgactgctgcaagtaaaggaagtagcgaactacgctgcctttttggct
agcaagaaagcgtcaggcgttacgggccaagctgtcgtcattgatggcgggtatacagcg
cagtaa

DBGET integrated database retrieval system