KEGG   Brevibacillus brevis: BBR47_07070Help
Entry
BBR47_07070       CDS       T00879                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbe  Brevibacillus brevis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBR47_07070 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_07070 (glcK)
   00052 Galactose metabolism
    BBR47_07070 (glcK)
   00500 Starch and sucrose metabolism
    BBR47_07070 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BBR47_07070 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBR47_07070 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BBR47_07070 (glcK)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBR47_07070 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(746835..747809)
Genome map
AA seq 324 aa AA seqDB search
MKKIIVGVDVGGTAIKMALITPDGELVTKMQEPTPVADGEDGILQKIVDMSHDLLAQHGY
SLAQVCGIGVGVPGPVDGEKGIVFQAVNLHWRQPVLLKEKLEALTGLPVAVDNDANVAAL
GEMWQGAGQGAQDLVLITLGTGVGGGVILNGKVIHGINGVGGEIGHITMTPDSGAPCNCG
KTGCLETYTSATAIIREGRFAATNGSSPALAAVLAAKGSIAAKDVLEAAVAGDTAALAII
DQVALYLGLALSHLANVLNPAKFMIGGGVAAAGDFLFSRIRESFKRFVPFSYVVESTEIV
PAKLGNDAGVYGAGWLIRSQMHES
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagatcatcgtgggagtagatgtgggtggcactgcaatcaagatggctttgatt
acgccagacggcgagctggttacaaaaatgcaagaaccgacgccagttgcggacggcgag
gatggcattttgcaaaaaatcgtagacatgtctcatgatcttcttgcgcagcatggctat
tctcttgcacaagtctgcggaatcggtgtaggcgtacccggccccgttgatggcgagaag
ggaatcgtcttccaagcggtgaatcttcactggcgccaacccgttttgttaaaagaaaaa
ttggaagcccttacaggtctgccggtagcggtcgacaacgatgccaatgtcgcagccctc
ggggaaatgtggcaaggtgcaggccaaggtgcacaagacctcgttctcattacactcggc
acaggtgtaggtggaggcgtcattttgaatggaaaggtcatccatggcattaacggtgtg
ggcggcgaaatcggtcacatcacgatgactccagatagcggtgccccttgcaattgcggc
aaaacaggttgtctcgaaacatatacgtctgcgactgccatcattcgtgaagggcgattt
gccgctacaaacggatcaagcccagcacttgccgctgtactagccgccaaaggaagcatt
gccgccaaggatgtcctcgaggcagccgtagcaggagacacagcagctctcgcgattatc
gatcaagtggcactctatctcggtctcgctctctctcatttggcgaatgtgctcaatcct
gctaagtttatgatcggtggtggcgtggctgcagcaggtgacttcctcttttcccgaatc
cgcgaatcattcaaacgcttcgttccattcagctatgtcgttgagtccacagagatcgtt
ccggccaaactcggcaatgatgcgggggtgtacggtgcgggctggttaatccgctcacag
atgcacgaatcctga

DBGET integrated database retrieval system