KEGG   Brevibacillus brevis: BBR47_13830Help
Entry
BBR47_13830       CDS       T00879                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbe  Brevibacillus brevis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBR47_13830 (pfk)
   01230 Biosynthesis of amino acids
    BBR47_13830 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_13830 (pfk)
   00030 Pentose phosphate pathway
    BBR47_13830 (pfk)
   00051 Fructose and mannose metabolism
    BBR47_13830 (pfk)
   00052 Galactose metabolism
    BBR47_13830 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BBR47_13830 (pfk)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BBR47_13830 (pfk)
Protein phosphatases and associated proteins [BR:bbe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BBR47_13830 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1422784..1423743
Genome map
AA seq 319 aa AA seqDB search
MRKLAVLTSGGDSPGMNAAVRAAVRRAHFHEVQMFGVYHGYEGLMRGDIKEMSLGSVGDI
IQRGGTILYSARSEAFKTEAGQQRAVEQLRAHEIEGLIVIGGDGSFRGAQKLTEKGFPTI
GVPGTIDNDIPCTDFTIGFDTALNTVVEAIDKIRDTATSHERTYIIEVMGRDAGDLALWA
GLAAGAESIMIPEASQDMDDIIERLHAGQRRGKKHSIIIVAEGVGSAASYAEAITKETGW
ETRVTVLGHIQRGGSPTAMDRMLASRMGAAAVDLLLEGKQDRMVGVQNNQIVDVDFQEAL
AKKHQLDLSIYQLARTLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaacttgcagttctcactagcggtggagattctcctggaatgaatgccgccgtc
cgtgcggctgtacgtcgtgctcattttcacgaggtacaaatgtttggggtttaccacgga
tacgaagggctgatgaggggagatatcaaggagatgtctctaggctctgttggggatatt
atccaacggggaggaaccattctctactccgctcgcagtgaggcgttcaagacggaagcc
ggacagcaaagagcggtggaacaattacgtgctcatgaaattgagggtctgattgtcatt
gggggagacgggtcgtttcgcggtgcacagaagctaaccgaaaaaggtttcccgactatt
ggcgtaccgggtacgattgataatgatattccatgcaccgatttcacgatcgggtttgat
acggcattgaataccgtagtggaagcgatcgataaaatccgcgatacggccacctcgcat
gaacgcacgtacattattgaagtaatggggcgagatgctggcgatctggcattgtgggca
gggcttgcagctggtgccgagtccattatgatcccagaagcgtcgcaggatatggacgat
attattgaacgtttgcatgctggacaacgccgtggtaaaaagcattccatcatcattgtg
gcggaaggggtaggaagtgccgcttcttacgccgaagcgatcacgaaagagacaggctgg
gagactcgcgtgacggtactgggtcatattcaacgtggtggttcccctactgcgatggac
cgaatgctggcgagccgaatgggtgccgcagctgtcgatttgttgctggaaggcaagcag
gaccgaatggttggggttcaaaacaaccagatcgttgatgttgattttcaggaagcattg
gcgaaaaagcatcaattggatttatccatttatcaattggcgcgcacgctatctatataa

DBGET integrated database retrieval system