KEGG   Brevibacillus brevis: BBR47_18040Help
Entry
BBR47_18040       CDS       T00879                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bbe  Brevibacillus brevis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBR47_18040 (hemD)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BBR47_18040 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1896847..1897659
Genome map
AA seq 270 aa AA seqDB search
MIVHGSHKPLTGKCIMVTRARSQVRELVEQIERLGGEAYAFPLLKMMPPTDTAKLDEAIT
QLPAFDWVVFTSVNGVRFFLERMREVGVGLEAFTGKIAAVGPKTAKALEHHGLEVAVIPS
DYVAEGLLSSLYDQLLPGQRVLLPRADIARKALPKELARLGLAVTEVDVYHTVIDAEHAP
EAAEKLQQGLIDIILFTSSSTVTHFMAAMEPYASLDWLKHVQIACIGPITADTAKQNGLS
VHAVASEYTVEGLLAAIIENLGGNRHGTNI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattgtccacggatcgcacaagccgctgactggcaagtgcatcatggtcacccgggca
agaagtcaagttcgcgagctcgttgaacagatcgagcggttgggtggagaagcatacgca
tttcccctgctaaaaatgatgccgccgacggacactgccaagctcgacgaagccatcacc
cagttgccagcattcgactgggtggtcttcacgagtgtgaatggcgtgcgctttttcttg
gagcgcatgcgcgaggtcggggttggccttgaagcgttcactggcaaaattgctgcggtc
ggtccgaaaacggccaaggcgcttgagcatcacgggctcgaagtagctgtcatcccgtct
gattacgtcgcggagggcttgctgtcgagcttgtatgatcagttgcttcctggtcagcga
gttctgctgcctcgtgcagatattgcgcgcaaggcattgccaaaggagttggctcgcttg
gggcttgctgtgacagaggtagacgtgtatcacactgtcattgatgcagagcacgctcca
gaagcagcggaaaaactacagcaaggtctcattgatatcatcttgtttaccagctcttca
acggtgacgcatttcatggcagcgatggagccctatgcatcgttagactggctcaagcac
gttcagatagcctgtatcggaccgataacggcagatacagcaaagcaaaacggactttct
gttcatgcagtagcaagtgagtacaccgtggaaggattactagcagcaatcatagagaat
ctgggagggaatcgacatggcacaaacatttga

DBGET integrated database retrieval system