KEGG   Brevibacillus brevis: BBR47_18050Help
Entry
BBR47_18050       CDS       T00879                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bbe  Brevibacillus brevis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bbe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1897643..1898617
Genome map
AA seq 324 aa AA seqDB search
MAQTFDRHRRLRKSAAMRNLVRENHVRVEDLIYPLFVVEGTGIKNEIPSMPGVYQLSLDT
LAEELKEIVALGIQAVLMFGVPTHKDACGTEAYNDDAITQQAMRLIKEAHPEMIVIADTC
LCEYTDHGHCGVIHEGEVVNDETLKLLGQTAVSQAKAGADIIAPSNMMDGFVIAIREALD
EAGFEHIPIMSYAVKYASAFYGPFRDAAGSTPQFGDRKSYQMDAANAREGLREAASDVKE
GADFLIVKPGLAFMDMVLRLRENFNLPIVAYNVSAEYSMVKAAALNGWIDEERIVMETLV
GFKRAGADMIITYHAKDVAKWLAR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacatttgaccgtcatcgccgccttcgcaaaagcgcggctatgcgcaatctg
gtgcgggagaaccacgtacgggtggaggacttgatttacccgttgttcgtagtggaagga
accggtattaagaacgagattccgtccatgccaggcgtgtatcagctctccttggacacg
ctggccgaagagttgaaggaaatcgtagctctgggaattcaagctgttctgatgtttggg
gtaccaacacataaagacgcatgcggaacagaggcgtacaatgatgatgcgattacccag
caggcgatgcgtctgatcaaggaagcccatccggaaatgatcgtgattgcagatacatgc
ctgtgtgaatacaccgatcatggtcactgtggtgtcattcacgaaggtgaagttgtgaat
gatgaaaccttgaagcttttgggtcagactgccgtttcccaagcaaaagctggagcagat
attattgcaccttccaatatgatggacggtttcgtgattgcaatccgtgaagcgttggac
gaggctggttttgagcatattccgatcatgtcctatgcggtgaaatacgcttctgccttc
tacgggccgttccgcgatgcggcaggctccactccacaattcggcgatcgcaaaagctac
caaatggacgcggccaatgcacgtgaaggtctgcgcgaggcagcttccgatgtaaaagaa
ggcgcggacttcttgatcgtcaagccaggtcttgccttcatggacatggttcttcgtctg
cgtgagaacttcaacctgccgatcgtggcttacaatgtgagtgccgagtattccatggta
aaagcggcagctttgaatggctggatcgatgaagagcgtatcgttatggaaacattggtt
ggcttcaaacgcgcaggtgcagatatgatcattacgtaccacgcaaaagatgttgcaaaa
tggctggcgaggtga

DBGET integrated database retrieval system