KEGG   Brevibacillus brevis: BBR47_18050Help
Entry
BBR47_18050       CDS       T00879                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bbe  Brevibacillus brevis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBR47_18050 (hemB)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BBR47_18050 (hemB)
Exosome [BR:bbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBR47_18050 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1897643..1898617
Genome map
AA seq 324 aa AA seqDB search
MAQTFDRHRRLRKSAAMRNLVRENHVRVEDLIYPLFVVEGTGIKNEIPSMPGVYQLSLDT
LAEELKEIVALGIQAVLMFGVPTHKDACGTEAYNDDAITQQAMRLIKEAHPEMIVIADTC
LCEYTDHGHCGVIHEGEVVNDETLKLLGQTAVSQAKAGADIIAPSNMMDGFVIAIREALD
EAGFEHIPIMSYAVKYASAFYGPFRDAAGSTPQFGDRKSYQMDAANAREGLREAASDVKE
GADFLIVKPGLAFMDMVLRLRENFNLPIVAYNVSAEYSMVKAAALNGWIDEERIVMETLV
GFKRAGADMIITYHAKDVAKWLAR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacatttgaccgtcatcgccgccttcgcaaaagcgcggctatgcgcaatctg
gtgcgggagaaccacgtacgggtggaggacttgatttacccgttgttcgtagtggaagga
accggtattaagaacgagattccgtccatgccaggcgtgtatcagctctccttggacacg
ctggccgaagagttgaaggaaatcgtagctctgggaattcaagctgttctgatgtttggg
gtaccaacacataaagacgcatgcggaacagaggcgtacaatgatgatgcgattacccag
caggcgatgcgtctgatcaaggaagcccatccggaaatgatcgtgattgcagatacatgc
ctgtgtgaatacaccgatcatggtcactgtggtgtcattcacgaaggtgaagttgtgaat
gatgaaaccttgaagcttttgggtcagactgccgtttcccaagcaaaagctggagcagat
attattgcaccttccaatatgatggacggtttcgtgattgcaatccgtgaagcgttggac
gaggctggttttgagcatattccgatcatgtcctatgcggtgaaatacgcttctgccttc
tacgggccgttccgcgatgcggcaggctccactccacaattcggcgatcgcaaaagctac
caaatggacgcggccaatgcacgtgaaggtctgcgcgaggcagcttccgatgtaaaagaa
ggcgcggacttcttgatcgtcaagccaggtcttgccttcatggacatggttcttcgtctg
cgtgagaacttcaacctgccgatcgtggcttacaatgtgagtgccgagtattccatggta
aaagcggcagctttgaatggctggatcgatgaagagcgtatcgttatggaaacattggtt
ggcttcaaacgcgcaggtgcagatatgatcattacgtaccacgcaaaagatgttgcaaaa
tggctggcgaggtga

DBGET integrated database retrieval system