KEGG   Brevibacillus brevis: BBR47_18160Help
Entry
BBR47_18160       CDS       T00879                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00860  Porphyrin and chlorophyll metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBR47_18160 (hemY)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BBR47_18160 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BBR47_18160 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO MCRA NAD_binding_9 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: BAH42793
NITE: BBR47_18160
UniProt: C0ZAI4
Position
1908074..1909483
Genome map
AA seq 469 aa AA seqDB search
MSDNTYHITIIGGGITGLAAAFYLQKEIEAKGLPIRFRLLEEQGRLGGKIKTWRHEGFVI
EQGPDSFLERKTSAAELAVDLGLGDDLVRNSTGQAYIWHQDRLKAIPEGAVMGVPTKVMP
FVTTDLISWPGKLRAALDLVLPASKGDGDISVGDFFRRRLGNEVIDNLIAPLLSGVYSGD
LDNLSLLASFPQFAKMEEQHRSLIVAMKHSRPQAKTQGKPKGIFLTLKNGLQSFVEAIEK
SLPEEVISKNTGVKELVKRPDGKYTLVLKNGETVETDTVLFTVPHAVAEPLFRPYVQVPT
LPQAKPHMVATIAMAFPESAIDLGMEGTGFIVPRNSGAKITACTWAHRKWPHTTPKNKAL
LRSFVGRAGEQSFMEQTDEEILEVVLRDLRKIMTIRAEPDFYNVSRLQNAIPYVVGHQAW
VQDVNNQLKEKLPGVIVAGASYSGVGVPDCIDQGKKAIAEWIASVIPGR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataatacctatcatattacaattataggcggcggcataacagggctggccgct
gctttttacttacaaaaggaaatcgaagcaaaaggcttgcccatccgttttcgactgctt
gaagagcagggacgacttggtgggaaaatcaagacatggcgtcacgaaggatttgtcatt
gagcaaggtcccgattcgtttctcgagcggaaaacaagcgcggctgagctggctgtagac
ttggggcttggggatgatctcgttcgcaacagtacaggccaagcttatatctggcatcag
gatcgcctgaaggctataccagaaggagcggtcatgggtgtaccgacaaaggtcatgcct
tttgtcacgaccgatctcatttcttggccgggcaagcttcgggctgccttggatcttgtt
cttcctgcctcaaaaggagacggcgatatctccgtgggtgacttttttcggcgtaggtta
ggtaatgaagttattgataatcttatagcgcccttattgtccggtgtctactccggggat
ctcgacaatctcagcttgcttgcgagttttcctcaattcgctaaaatggaagagcagcat
cgcagcttgattgtagcgatgaagcattcgcgcccacaagcaaaaacgcagggaaagcca
aaaggcatcttcctgacattgaaaaacggcttgcagtcttttgttgaggcaatcgagaag
agcttgcctgaagaagtcatctcgaagaatactggtgtcaaagaactggtgaaacggcca
gacgggaagtacaccttggtattgaaaaatggagaaacggttgagacggatacggtgctg
tttaccgtaccacatgctgtggcagagccattgttccgtccgtatgtacaagtgcctacc
ttgccacaagcgaagccgcatatggtggcaaccattgcgatggcatttccagagtcagcc
attgatttagggatggaagggacaggatttattgtaccgcggaattctggcgcaaaaatt
acggcgtgtacgtgggcgcatcgcaaatggccgcatacgacgccgaaaaacaaagccttg
ctgcgtagctttgtggggagagcaggagagcaatccttcatggagcagacggacgaggaa
attctggaggttgtcctccgcgatctgcgcaagatcatgacgattcgagcagagccggat
ttttataacgtatcacgcttgcaaaatgccattccatatgttgtgggacatcaggcttgg
gtgcaggatgtgaacaatcaattaaaagaaaaactccctggtgttatcgtggcaggtgcg
tcgtacagtggcgtaggtgtaccagattgtattgatcaggggaaaaaagcaatagcagaa
tggatagcgtcagtaataccggggagatag

DBGET integrated database retrieval system