KEGG   Brevibacillus brevis: BBR47_18550Help
Entry
BBR47_18550       CDS       T00879                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbe  Brevibacillus brevis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBR47_18550 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBR47_18550 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BBR47_18550 (thrC)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BBR47_18550 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1947711..1948793
Genome map
AA seq 360 aa AA seqDB search
MAFNRQSGILERYREFLPITEKTPLVSLHEGNTPLIHAPNLSKQLGVELYVKYEGLNPTG
SFKDRGMVMAVAKAVEEGSNTIMCASTGNTSAAAAAYAARSGLRCIVLIPSGNIALGKLA
QAIAYGAEVIAIDGNFDEALDIVREITAKEPITLVNSVNPYRIEGQKTAAFEVCDALTDA
PDILAIPVGNAGNITAYWKGFEEYFAAKKSNRLPKMYGFQAAGAAPLVHGEPVSNPETIA
TAIRIGNPASKDGALNAISKSNGLVDSVTDEEILHAYHLLAKSEGVFCEPASAASLAGII
KLHEAGRLQPGSQIVCVLTGNGLKDPNIALKLVGEEPRSVPATHEAVMELVRQSGREFVS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaatagacagtctggcatcctagaacgttaccgggaatttctcccgattacg
gaaaaaactccgctggtcagcttgcatgaaggaaacactccgctgatccatgccccgaac
ctatccaaacaattgggggtggagctgtacgtcaagtacgaggggctcaatccgaccgga
tctttcaaagatagaggcatggtcatggctgtagccaaagcggttgaagagggaagcaac
acaatcatgtgcgcttcgacggggaatacatcagcagcagcagcggcgtatgcggcacgt
tcaggattgcgttgcatcgtcctgatcccaagcggcaatatcgcactgggcaagctggca
caggccatcgcctatggtgcagaagtgatcgcgattgacggtaattttgatgaagcactg
gatattgttcgggaaatcacagcgaaagagccaattacactggtgaattccgtgaaccct
taccggatcgaaggacaaaagactgcggcatttgaagtgtgcgatgcgttgacagacgct
cctgacattttggctattccagttggtaacgcaggtaacattacggcatactggaagggc
ttcgaggaatatttcgcagccaaaaaatcgaatcgcttgcctaagatgtacggattccag
gcagccggagcagctccgttggttcacggcgaacccgtatccaaccctgaaacgattgcg
acagcgattcgaattggcaacccagcgagcaaggatggcgctttgaatgccatttcgaaa
tcaaacggtcttgtcgatagtgtaacagacgaagaaattttacatgcttatcatttgctg
gcgaagagtgaaggcgtgttttgtgagcctgcctcggcagcatcactggcgggtattatc
aagctgcatgaggctggaaggctccaacctggcagccagatcgtgtgcgtactgactgga
aacggactaaaagatcccaatatcgctttgaagctggtaggtgaagagccgcgttctgta
ccggcgacacatgaagctgtaatggagctggttcgtcaaagtgggagagaatttgtatca
tga

DBGET integrated database retrieval system