KEGG   Brevibacillus brevis: BBR47_18550Help
Entry
BBR47_18550       CDS       T00879                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbe  Brevibacillus brevis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBR47_18550 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBR47_18550 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BBR47_18550 (thrC)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BBR47_18550 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1947711..1948793
Genome map
AA seq 360 aa AA seqDB search
MAFNRQSGILERYREFLPITEKTPLVSLHEGNTPLIHAPNLSKQLGVELYVKYEGLNPTG
SFKDRGMVMAVAKAVEEGSNTIMCASTGNTSAAAAAYAARSGLRCIVLIPSGNIALGKLA
QAIAYGAEVIAIDGNFDEALDIVREITAKEPITLVNSVNPYRIEGQKTAAFEVCDALTDA
PDILAIPVGNAGNITAYWKGFEEYFAAKKSNRLPKMYGFQAAGAAPLVHGEPVSNPETIA
TAIRIGNPASKDGALNAISKSNGLVDSVTDEEILHAYHLLAKSEGVFCEPASAASLAGII
KLHEAGRLQPGSQIVCVLTGNGLKDPNIALKLVGEEPRSVPATHEAVMELVRQSGREFVS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaatagacagtctggcatcctagaacgttaccgggaatttctcccgattacg
gaaaaaactccgctggtcagcttgcatgaaggaaacactccgctgatccatgccccgaac
ctatccaaacaattgggggtggagctgtacgtcaagtacgaggggctcaatccgaccgga
tctttcaaagatagaggcatggtcatggctgtagccaaagcggttgaagagggaagcaac
acaatcatgtgcgcttcgacggggaatacatcagcagcagcagcggcgtatgcggcacgt
tcaggattgcgttgcatcgtcctgatcccaagcggcaatatcgcactgggcaagctggca
caggccatcgcctatggtgcagaagtgatcgcgattgacggtaattttgatgaagcactg
gatattgttcgggaaatcacagcgaaagagccaattacactggtgaattccgtgaaccct
taccggatcgaaggacaaaagactgcggcatttgaagtgtgcgatgcgttgacagacgct
cctgacattttggctattccagttggtaacgcaggtaacattacggcatactggaagggc
ttcgaggaatatttcgcagccaaaaaatcgaatcgcttgcctaagatgtacggattccag
gcagccggagcagctccgttggttcacggcgaacccgtatccaaccctgaaacgattgcg
acagcgattcgaattggcaacccagcgagcaaggatggcgctttgaatgccatttcgaaa
tcaaacggtcttgtcgatagtgtaacagacgaagaaattttacatgcttatcatttgctg
gcgaagagtgaaggcgtgttttgtgagcctgcctcggcagcatcactggcgggtattatc
aagctgcatgaggctggaaggctccaacctggcagccagatcgtgtgcgtactgactgga
aacggactaaaagatcccaatatcgctttgaagctggtaggtgaagagccgcgttctgta
ccggcgacacatgaagctgtaatggagctggttcgtcaaagtgggagagaatttgtatca
tga

DBGET integrated database retrieval system