KEGG   Brevibacillus brevis: BBR47_18960Help
Entry
BBR47_18960       CDS       T00879                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bbe  Brevibacillus brevis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BBR47_18960
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BBR47_18960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1993012..1995273
Genome map
AA seq 753 aa AA seqDB search
MDEQQSISLFAETYIRGFVSQEIFYNEETWYGVIRLKIEETTESIKESEVIIVGNFPRPH
PDELYTFYGEWKTHARFGQQYVAKRYERETPKTLAGVERYLASGLFQGIGKKMAKRIVEQ
LGVDALSIIADFPERLAEVPGISEQRAKTIYDSVVEHRSLESAMVFLYDFGIGVNMALRI
YQTYKIETMTVLKEEPYRLIEDVVGIGFKRADDIARATGIAASSEERVKAAALFMLQEAS
YSEGHVYLPVEELCEKTLRLLEECGGHVFSGDDIQLAVEALFVSSKIAWEDERVYLPSLF
FAELGLAKRLRHFASRDEFGTFPTSEFYRALGAVEDELGITYAQTQRDAIEQAIKAGLML
LTGGPGTGKTTVIRGICRVFSQLHGLSLDLKKYNEENPFPIVLVAPTGRAAKRMTETTGL
PAMTIHRLLGYKGESFEHDAEHPIRGRLLIVDEMSMVDIWLANQLFRAVPDDMQIIMVGD
PDQLPSVGPGNVLLDMIRSGLLPLVQLTEIYRQAEESTIIRLAHDVRKGNVPADLLHTTP
DRRFFTSLPQEVPEAVKQICFGAVKKGYTAKDVQVLAPIYKGNAGVNRLNEELQELFNPK
TPQKREVTFGETTFRTGDKVLQLVNNAEEQVFNGDMGEIVAIFFPNENAENQEMLVAAFD
NREVVYKRSDYHQLTLAYCCSVHKSQGSEFPIVIMPFVKSYYRMLRRKLVYTGITRSKSF
LIMCGEPDAFRAAVESDEEGVRYSYLEERLKQE
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcagcagtcaatctcgctgtttgcggaaacctacattcgaggatttgtttct
caagaaattttttacaatgaagaaacctggtacggagttatccgtcttaagatagaagag
actaccgaatcgattaaagaatcggaggtcattattgtcggtaattttcctcgcccgcat
ccagatgagctgtacaccttttacggtgaatggaaaacacatgctcgttttggacagcag
tacgtagcaaaacgctatgaacgtgaaacgccgaaaacattggcaggggtagagcgctac
ttagccagtggcttgtttcaagggatcggaaagaagatggccaaacgaattgtcgagcag
ctcggggtagatgcactgtcgattatcgcagacttcccagagcgattggctgaggtacca
ggcatttctgaacaacgtgccaaaacgatctatgattccgtggtcgagcatcgctccttg
gaaagtgccatggttttcttgtacgacttcggcattggtgtgaacatggcactgcgtatt
tatcagacctacaagatagaaacgatgacagtgctgaaggaagagccttaccgtttgatt
gaggatgtcgtaggaatcggctttaagcgagcagatgacattgcacgagcaactgggatt
gctgcttcctcagaagaacgtgtgaaggcggcggctctctttatgttgcaggaggcatcg
tattcggaagggcatgtttatttgcctgtggaggagctttgtgaaaaaacactgcgcctt
ctcgaagagtgcggggggcacgtcttttccggagacgatattcaactggcagtggaagcc
ctgttcgtgtcgagcaaaattgcctgggaagatgagcgggtttatttgccctcgctgttt
tttgccgagcttggtctagccaaaagactgcgtcacttcgcatcacgggatgaattcggt
acgtttccgacatcggaattttaccgtgcgttaggggcggtcgaggatgagctggggatt
acgtatgcccagacgcagcgtgatgccattgaacaggcgatcaaagcaggtttgatgctg
ttgacagggggacctggtacggggaaaacgacagtcattcgtgggatatgtcgtgtcttt
tctcagcttcatggattgtcgctggacttgaaaaaatacaacgaagaaaatccattcccg
atcgttcttgtggctcctaccggacgtgcagcaaaacgtatgacagagactacgggttta
cctgcaatgaccatccatcgcttgctcggttacaaaggggagagctttgagcatgacgcg
gagcacccaatccgtggacggctattaattgtggatgaaatgtccatggtcgatatctgg
cttgccaatcaattgtttcgtgcggttccagacgacatgcagatcatcatggtaggtgac
cctgaccagttgccttctgtaggaccgggcaacgttctgctggatatgatccgatctgga
ttgcttccgttggtacagctgacagaaatttatcggcaagctgaagagtctaccattatt
cggttggcccatgatgtacgcaaggggaatgtaccggcagatttgcttcacaccaccccg
gatcggcgattcttcacaagtttgccacaagaagttccggaagcagtgaaacaaatttgc
ttcggagccgtaaaaaaaggatatacggcaaaagatgttcaggtattagcccctatctat
aaaggtaatgccggtgtgaaccggttgaatgaagaattgcaggagctgtttaatccgaaa
acgccgcaaaagcgtgaagttacttttggagagacgacgttccgtacaggagacaaggtt
ctgcaattggtgaacaatgctgaagaacaggtgtttaacggtgacatgggtgagatcgtc
gccatctttttcccgaatgaaaatgcggagaaccaggagatgctggtcgctgcctttgat
aacagggaagtggtgtacaagcgttcggattaccatcagctgacgcttgcctactgctgc
tcggttcataagtctcaaggtagtgaatttccgattgtgatcatgccgtttgtcaaaagt
tactaccgtatgctcagacgtaagttggtctataccgggatcacccggagcaaatcattc
ctcatcatgtgtggagagccggatgcgttccgtgctgctgtagagtctgatgaggaaggg
gtacggtacagttatttggaggaacggctaaagcaagagtga

DBGET integrated database retrieval system