KEGG   Brevibacillus brevis: BBR47_18960Help
Entry
BBR47_18960       CDS       T00879                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bbe  Brevibacillus brevis
Pathway
bbe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BBR47_18960
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BBR47_18960
DNA repair and recombination proteins [BR:bbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BBR47_18960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 AAA_22 AAA UvrD-helicase T2SSE AAA_16 UvrD_C TsaE NTPase_1 AAA_29 AAA_23 Zeta_toxin AAA_28 AAA_12
Motif
Other DBs
NCBI-ProteinID: BAH42873
NITE: BBR47_18960
UniProt: C0ZAR4
Position
1993012..1995273
Genome map
AA seq 753 aa AA seqDB search
MDEQQSISLFAETYIRGFVSQEIFYNEETWYGVIRLKIEETTESIKESEVIIVGNFPRPH
PDELYTFYGEWKTHARFGQQYVAKRYERETPKTLAGVERYLASGLFQGIGKKMAKRIVEQ
LGVDALSIIADFPERLAEVPGISEQRAKTIYDSVVEHRSLESAMVFLYDFGIGVNMALRI
YQTYKIETMTVLKEEPYRLIEDVVGIGFKRADDIARATGIAASSEERVKAAALFMLQEAS
YSEGHVYLPVEELCEKTLRLLEECGGHVFSGDDIQLAVEALFVSSKIAWEDERVYLPSLF
FAELGLAKRLRHFASRDEFGTFPTSEFYRALGAVEDELGITYAQTQRDAIEQAIKAGLML
LTGGPGTGKTTVIRGICRVFSQLHGLSLDLKKYNEENPFPIVLVAPTGRAAKRMTETTGL
PAMTIHRLLGYKGESFEHDAEHPIRGRLLIVDEMSMVDIWLANQLFRAVPDDMQIIMVGD
PDQLPSVGPGNVLLDMIRSGLLPLVQLTEIYRQAEESTIIRLAHDVRKGNVPADLLHTTP
DRRFFTSLPQEVPEAVKQICFGAVKKGYTAKDVQVLAPIYKGNAGVNRLNEELQELFNPK
TPQKREVTFGETTFRTGDKVLQLVNNAEEQVFNGDMGEIVAIFFPNENAENQEMLVAAFD
NREVVYKRSDYHQLTLAYCCSVHKSQGSEFPIVIMPFVKSYYRMLRRKLVYTGITRSKSF
LIMCGEPDAFRAAVESDEEGVRYSYLEERLKQE
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcagcagtcaatctcgctgtttgcggaaacctacattcgaggatttgtttct
caagaaattttttacaatgaagaaacctggtacggagttatccgtcttaagatagaagag
actaccgaatcgattaaagaatcggaggtcattattgtcggtaattttcctcgcccgcat
ccagatgagctgtacaccttttacggtgaatggaaaacacatgctcgttttggacagcag
tacgtagcaaaacgctatgaacgtgaaacgccgaaaacattggcaggggtagagcgctac
ttagccagtggcttgtttcaagggatcggaaagaagatggccaaacgaattgtcgagcag
ctcggggtagatgcactgtcgattatcgcagacttcccagagcgattggctgaggtacca
ggcatttctgaacaacgtgccaaaacgatctatgattccgtggtcgagcatcgctccttg
gaaagtgccatggttttcttgtacgacttcggcattggtgtgaacatggcactgcgtatt
tatcagacctacaagatagaaacgatgacagtgctgaaggaagagccttaccgtttgatt
gaggatgtcgtaggaatcggctttaagcgagcagatgacattgcacgagcaactgggatt
gctgcttcctcagaagaacgtgtgaaggcggcggctctctttatgttgcaggaggcatcg
tattcggaagggcatgtttatttgcctgtggaggagctttgtgaaaaaacactgcgcctt
ctcgaagagtgcggggggcacgtcttttccggagacgatattcaactggcagtggaagcc
ctgttcgtgtcgagcaaaattgcctgggaagatgagcgggtttatttgccctcgctgttt
tttgccgagcttggtctagccaaaagactgcgtcacttcgcatcacgggatgaattcggt
acgtttccgacatcggaattttaccgtgcgttaggggcggtcgaggatgagctggggatt
acgtatgcccagacgcagcgtgatgccattgaacaggcgatcaaagcaggtttgatgctg
ttgacagggggacctggtacggggaaaacgacagtcattcgtgggatatgtcgtgtcttt
tctcagcttcatggattgtcgctggacttgaaaaaatacaacgaagaaaatccattcccg
atcgttcttgtggctcctaccggacgtgcagcaaaacgtatgacagagactacgggttta
cctgcaatgaccatccatcgcttgctcggttacaaaggggagagctttgagcatgacgcg
gagcacccaatccgtggacggctattaattgtggatgaaatgtccatggtcgatatctgg
cttgccaatcaattgtttcgtgcggttccagacgacatgcagatcatcatggtaggtgac
cctgaccagttgccttctgtaggaccgggcaacgttctgctggatatgatccgatctgga
ttgcttccgttggtacagctgacagaaatttatcggcaagctgaagagtctaccattatt
cggttggcccatgatgtacgcaaggggaatgtaccggcagatttgcttcacaccaccccg
gatcggcgattcttcacaagtttgccacaagaagttccggaagcagtgaaacaaatttgc
ttcggagccgtaaaaaaaggatatacggcaaaagatgttcaggtattagcccctatctat
aaaggtaatgccggtgtgaaccggttgaatgaagaattgcaggagctgtttaatccgaaa
acgccgcaaaagcgtgaagttacttttggagagacgacgttccgtacaggagacaaggtt
ctgcaattggtgaacaatgctgaagaacaggtgtttaacggtgacatgggtgagatcgtc
gccatctttttcccgaatgaaaatgcggagaaccaggagatgctggtcgctgcctttgat
aacagggaagtggtgtacaagcgttcggattaccatcagctgacgcttgcctactgctgc
tcggttcataagtctcaaggtagtgaatttccgattgtgatcatgccgtttgtcaaaagt
tactaccgtatgctcagacgtaagttggtctataccgggatcacccggagcaaatcattc
ctcatcatgtgtggagagccggatgcgttccgtgctgctgtagagtctgatgaggaaggg
gtacggtacagttatttggaggaacggctaaagcaagagtga

DBGET integrated database retrieval system