KEGG   Brevibacillus brevis: BBR47_19980Help
Entry
BBR47_19980       CDS       T00879                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bbe  Brevibacillus brevis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bbe00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2081729..2083657)
Genome map
AA seq 642 aa AA seqDB search
MCGIVSLYNKRQKPVQQEAISAMTGVILHRGPDDDGFHLEDNIALGFRRLSIIDVEGGHQ
PLFNETRDIWIIGNGEIYNYKELQQWLKDIGHVFHTDSDIETILHLYEEVGTDAPKHLRG
MFGFTIYDSRKKRLFGARDHFGIKPLYYVETNDSIGVASEIKSLLELPGFKREVNPTAFY
HYLTFQYVPDPETMFAGIYRIPPAHSFVVENDQIKLERYWDVEFKPDESKPFSYFVEGTR
SVMLESVDKHRISEVSRGAFLSSGVDSSSIVGMLRTFEPVKSFSVGSDIPGYSELDYAKR
TAAYLGSEHFERVINAKQYMDELPRLIWHQDEPVADPSAILLYFVAQMASEHVTVVLSGE
GADEFFGGYNIYREPHSLKMFSGMPGWMRQSIGYMAERLPDQVKGKNFLIRGSKTVEQRF
FGNALIFSEEMKKRVVMEDITRSESYVSPFTITEEIYKRASEYDDVTKMQYLDIHTWLRG
NILMKADKMTMANSLELRVPFIDLKVFEFAATIPTKYKIANGTTKHVLREAMKDFLPPEI
QSRKKLGFPVPTRHWLKNEFYKWAKEIIFESKVDNLINKAYVLYMLDEHREGNADYSRKI
WTILVFMLWHQIFIEQKHNFEPYVSPNVDLRRKKNSSLQHIG
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtatcactctataacaagcggcaaaagcctgttcaacaagaagcgatt
agtgcaatgacgggtgtcatcctgcaccgtggtccagatgacgatggttttcaccttgaa
gacaacatcgccctgggctttcgtcgtttaagcatcattgacgtggaaggcggacatcaa
ccgctgtttaacgaaacacgtgacatctggattatcggtaacggcgaaatctacaattac
aaagagttacagcaatggttaaaggacatcggtcacgttttccacaccgattctgatatt
gaaaccatcctccacctttatgaagaggtaggaacagatgcacctaagcatttacgcggg
atgtttggctttacgatctacgactcccgtaaaaaacgtctgtttggggcacgcgaccat
tttggaatcaagcctctctactatgttgagacgaatgattcgatcggggttgccagtgag
atcaaaagcttgctggagctgccaggcttcaagcgcgaagtgaatccaaccgctttttat
cactatttgacgttccaatatgtacctgatcctgaaacgatgtttgctggcatttaccgt
ataccacctgcacactcgttcgtggttgaaaacgaccagatcaagctggaaaggtactgg
gatgtagaattcaagcctgatgaaagcaagccgttctcttattttgttgagggtacgcgc
agtgtcatgcttgaatctgtcgacaaacaccgaattagcgaagtttctcgtggagccttc
ttgtctagtggtgttgactctagcagtatcgttgggatgttgcgtacatttgagccagtc
aaatctttttctgttggctctgatattcctggttatagcgagctcgattatgcgaagcga
accgcagcatacttgggatcggagcatttcgagcgcgtgataaacgccaagcagtacatg
gatgaattaccaagactgatctggcatcaggacgaaccggtagcagacccatctgccatc
ttgctctatttcgtagcacagatggcgagtgaacacgtaaccgttgtattgtccggtgaa
ggtgcagatgaattttttggcggatacaatatttacagagagcctcattctctcaaaatg
ttttccggaatgcctggctggatgcgccaatccatcggatacatggcagaacgcctccct
gatcaggtaaaagggaagaacttcctcatccgcgggtcgaaaacggttgaacagcgcttc
ttcggaaacgcactgattttcagcgaagagatgaaaaagcgcgtcgtcatggaggatatt
acccgttcggaatcgtatgtatctcctttcaccattacagaagagatttacaaacgcgct
tccgaatatgatgatgtgaccaagatgcaatacttggacattcacacttggctcagaggc
aacattttgatgaaggccgacaagatgacgatggccaattctttggagttgcgagtgcct
ttcattgatctgaaggtatttgaattcgccgctaccattccaaccaagtacaaaattgcc
aacggcacgaccaagcacgttcttcgtgaagcgatgaaagacttcttaccacctgagatc
caatcgagaaaaaagctgggcttccctgttccgactcgtcattggctcaaaaacgaattt
tacaaatgggcaaaagagatcatttttgaatccaaggtggataatttgatcaataaggcc
tatgtgctctacatgctcgatgaacaccgtgaaggcaatgcggattacagccgcaaaatc
tggacgatcctggtcttcatgctgtggcatcagatcttcattgagcaaaagcacaatttt
gagccttatgtcagcccgaatgtagaccttcgccgcaagaaaaattcttcgctgcagcat
atcggctaa

DBGET integrated database retrieval system