KEGG   Brevibacillus brevis: BBR47_24590Help
Entry
BBR47_24590       CDS       T00879                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bbe  Brevibacillus brevis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2535315..2535878
Genome map
AA seq 187 aa AA seqDB search
MMNVDLDKIQQAVRMILEAVGDDPDREGVLDTPKRVAKMYAEVFEGMHIDEEQYFETVFS
EDHEEMVLVKDIPFYSMCEHHLVPFFGKAHVAYVPRGGRVVGLSKLARAVDTVAKRPQLQ
ERITATVADSIMRKLDPHGVVVVVEAEHMCMTMRGVKKPGSKTITSAVRGMFEKDAAARA
EVISLMR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgtcgacttagataaaatacagcaagctgttcgcatgatcctagaggcagtg
ggggatgatcctgatcgtgaaggagtgctggatacccctaagcgagttgcgaaaatgtac
gccgaagtatttgagggcatgcatatagacgaagagcagtatttcgagactgtctttagc
gaagatcatgaggaaatggtgttagtaaaggacattccgttttactctatgtgtgagcat
cacttggttcccttcttcggaaaagcgcatgtcgcttacgtaccgcgtggaggccgcgta
gtaggactgagcaagctcgcgcgtgcggtcgataccgtggcgaaacgtccgcagttgcag
gaaagaattacagcgacagtagctgactcgattatgcgcaagctcgatccgcacggcgta
gttgtggtagtagaggcagagcatatgtgcatgacaatgcgtggcgtgaaaaagccaggc
tcaaaaacgatcacctctgctgttcgcggtatgtttgagaaagatgcggctgcgcgtgca
gaagtcattagtttgatgcgctaa

DBGET integrated database retrieval system