KEGG   Brevibacillus brevis: BBR47_24780Help
Entry
BBR47_24780       CDS       T00879                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbe  Brevibacillus brevis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBR47_24780 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBR47_24780 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBR47_24780 (trpA)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBR47_24780 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2552764..2553582
Genome map
AA seq 272 aa AA seqDB search
MTTALNRIDQLFADRDRKRFIPFLTVGDPTIEATFHLVKAMVEAGADLIELGVPYSDPLA
DGPTIQRASERALKNGVTIGDALQLVKRLRESGMEACIVLFTYFNPVLQYGIERFFADLA
AYGADGVVIPDLPIEESGPAVTAAKQNGIHVISLVAPTSSSRINTIGAQATGFLYCVSSL
GVTGARTDLREDLADFLERVKASTSVPTAVGFGISTPDQVRTVAPHADGVIVGSAIVQQI
EEHAEQLKDLKQMPVAVEKIKTFVHQLASALQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcttaacagaatcgatcaattattcgcggatcgtgatcgcaaacgattc
atcccatttctaaccgtaggcgatcctacaatagaagcaacctttcatctcgtaaaagcg
atggtcgaagcaggagcagatctcattgagctcggcgtcccttactccgatccattggca
gacggcccaacgattcaacgggcatcagagcgcgcgctgaaaaatggcgtgacgatcggg
gatgctttgcaattggtgaaaaggctacgcgaatcaggtatggaggcttgcatcgtcctg
ttcacgtacttcaatccggttttgcagtatggcattgagcgcttttttgccgatcttgct
gcttatggggcggacggtgttgtcattcccgatttgccgattgaggaaagcggtccagca
gtaaccgcagcaaaacagaatggcattcatgtcatttcactcgtggcaccaacttccagt
tccagaatcaatacgattggcgcgcaagcaaccggatttctttattgtgtatcgtcgctc
ggtgtgacgggtgcccgcacggacctgcgagaggatttggcagattttctggaacgagta
aaggcaagcacatcggttcctactgcggtgggcttcggaatatccacgccggatcaagta
cgcacagtagcaccccatgcggatggtgtcattgtgggaagcgccattgtacagcaaatt
gaggaacatgctgagcagctgaaagacctcaaacaaatgccagtagctgtagaaaaaata
aaaacctttgtacatcagttagccagtgcgctacaatag

DBGET integrated database retrieval system