KEGG   Brevibacillus brevis: BBR47_25710Help
Entry
BBR47_25710       CDS       T00879                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbe  Brevibacillus brevis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bbe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2644288..2645505
Genome map
AA seq 405 aa AA seqDB search
MNQVISFVDEQEVVRLTQELVRIPSVFRPDQAGANEERVALFVADYLRNMGLQVFYEEVV
PGRPNVIAFYDSGRPGKTLLFEAHTDVVTEGDRGAWSYDPFGGTISGGRIYGRGSCDTKG
NLAAAICAVKAIQRSKQSFTGKILLCIPCDEEGMMIGIKDFIRRGWANNVDAAIICEPEE
NQLCITQKGAMRAILRTFGKMAHGAMPLTGINPNTRMARAIVALEGLERKEMARLGEHPM
LGWPSITPTILQAPVKGDAQINVVPDQCMTTLDIRTVPGQDHQGLYKEISVILEGLSKED
DKFKATLEVIEERPWTLTGMKEEVVTAVASAYREITKKEPVYNGVPGATDGTFLHKAGIP
ILTTGAGDRHIPHHADEYVAIDQLIESTQLFALSALTFLTQPVRA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggtaatatcctttgttgacgagcaggaagttgtgcgcctaacgcaggagctc
gttagaattccgagtgtgtttcgccccgatcaggcaggagcgaatgaagagcgggtcgcg
ctatttgtcgccgattatcttcgcaatatggggttgcaggtcttctatgaagaggttgtt
ccgggcaggccaaatgtcatcgcgttttacgattcgggtagacctggcaaaacgcttttg
ttcgaagcccatacagatgtcgtaacagaaggggaccggggggcttggagctacgaccct
tttggcgggacaatatctggtgggcgtatctacgggcgaggctcctgtgacacaaaagga
aatctggctgccgcaatatgtgccgtcaaagcaatccaacgatccaaacagtcttttaca
ggaaaaatcctcctgtgcatcccttgcgatgaggagggcatgatgatcgggatcaaagat
ttcattcggcgcggctgggccaataatgtcgatgctgcgatcatctgtgaaccggaagaa
aatcagctctgcatcacgcaaaaaggagcgatgcgagcgattcttcgtacgtttggcaaa
atggcgcatggagctatgccattgacaggaatcaatccgaacacaaggatggcacgcgcc
atagtcgcattagaggggctggagcgcaaggaaatggctcgtctgggagagcacccgatg
ttgggctggccgagtatcactccgacgattttgcaggcaccggtcaaaggagacgctcaa
atcaacgtcgtaccagatcaatgcatgactacacttgatattcgcacggtacctgggcag
gaccaccaagggctgtacaaagaaatcagtgtcatattagaaggattaagtaaagaggat
gacaagttcaaagccaccttggaagtcatcgaagagcgtccttggacgttgactggcatg
aaggaagaagtcgtgaccgctgtcgcaagcgcctatcgggaaatcacgaaaaaagaaccc
gtatacaatggcgttccaggtgcgacagatggaaccttcctgcacaaggcaggcattccg
attttgacaacaggcgcaggcgatcgccacatccctcatcatgcagacgagtacgtagcc
attgaccaattgatagaatctactcagctttttgccttgtctgccttgacgtttttgacg
cagccggtacgagcttga

DBGET integrated database retrieval system