KEGG   Brevibacillus brevis: BBR47_25890Help
Entry
BBR47_25890       CDS       T00879                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00620  Pyruvate metabolism
bbe00640  Propanoate metabolism
bbe00680  Methane metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_25890
   00620 Pyruvate metabolism
    BBR47_25890
   00640 Propanoate metabolism
    BBR47_25890
  Energy metabolism
   00680 Methane metabolism
    BBR47_25890
Enzymes [BR:bbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BBR47_25890
Lipid biosynthesis proteins [BR:bbe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BBR47_25890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAH43566
NITE: BBR47_25890
UniProt: C0ZCQ7
Position
2662406..2663989
Genome map
AA seq 527 aa AA seqDB search
MELNMPVNYNFAAQVDEWSKKHPERRAVWELDEQGQEHILTYENLRQYSNKIANGLGSIG
IGHGDRVLVLVSRGTLAYGLYLALLKLGAVILPGSEMLRSKDIEYRINHAKVKAVISFAG
AMSEVDLTRGNCSTLQHYITTGEEKEGWISLEGLLQGQDTEFEVVNTKSDELAFLSYTSG
TTGGPKGVMHVHGWPFAHLAVAATQWLDVREGDVVWATAGPGWAKWIWSPFVSTLGLGAT
AFVYKGKFSAENYLTILQNYPVSVLCATPTEYRIMAKVTDLEQYKLSALRSACSAGEPLN
REVIDTFRRVFQLTVRDGYGQTENTLLVGTFVGMEPRPGSMGKPSPVVRIAIIDEEGAEL
PVGKVGDIAIDRHMVALFKGYLDDPGRTARAFRGDWYVTGDQGRMDEDGYIWFEGRSDDI
IISGGYTIGPFEVEDALVKHAAVAECAAVASPDPERGHVVKAFVILKKGNEPSEEMIVEL
QNHVKQLTAPYKYPRKIEFVQELPKTTSGKIRRIELRQQEAQQNQHL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaacatgccagtgaactataatttcgcagcccaggtggacgaatggtcgaaa
aaacatccagagagacgtgcggtttgggagttagatgagcaaggccaggagcatatcctt
acgtacgagaatttgcgccaatattcaaataaaatcgcaaatggactagggtccattgga
atcgggcatggagatcgggtactcgtcctggtttcccgaggaacattggcttacggtctc
tatttggcactactgaagctaggggcagtgattttgccagggtctgagatgctgcgttcc
aaagatatcgagtaccggatcaatcatgcaaaagtaaaggcagtgatcagcttcgcggga
gcaatgagtgaggttgatctgacgagaggcaactgttctaccttgcaacactacatcacg
acgggcgaagaaaaagaagggtggatttcgcttgaggggttgctccaggggcaggacaca
gaatttgaggtagtaaacacgaagtcggatgagctggccttcctgtcttatacttcaggg
acgactgggggaccaaaaggggttatgcatgttcacggttggccgtttgcgcatttggct
gtggcggctacacagtggctggacgttcgcgaaggtgatgtggtttgggcaacggctggg
cctggttgggccaagtggatctggagcccgtttgtctctacgttagggctgggagcgacc
gcgtttgtctataaaggaaagttttctgcggaaaattatttgacgattctgcaaaattac
ccggtgtctgttttgtgtgcgacgccaaccgagtacagaatcatggcaaaagtaacggat
ttagaacaatacaagctgtccgccctgcgctccgcatgttcggctggtgaaccgctcaat
cgggaagtgatcgacacattccgccgcgtcttccagttgaccgtgcgagatggatacgga
cagacagagaacactttactggtgggtacctttgtcggcatggagccaaggccaggttca
atgggcaagccatcgccagttgtaaggatcgccattattgacgaagaaggagcggagctg
ccagtaggcaaagtaggagatattgccattgatcgccatatggtggcgctattcaaaggc
tatctggatgatccggggcgcactgccagagcttttcggggtgactggtacgtgacgggt
gatcaaggccgcatggacgaagatggctacatctggttcgaaggacgttctgatgacatt
atcatctcaggtggatatacgattggtccgtttgaggtcgaggatgcgctggtgaagcat
gcggcggtagcggaatgtgcggcggttgccagtcctgatccggagcgtggtcatgtggta
aaagcgtttgtcatcctgaaaaaagggaatgagccatccgaagagatgatcgtggaattg
caaaaccatgtcaagcaattaactgctccgtataaatacccgcgcaaaatcgagtttgta
caagaactgccgaaaacaacctccggtaaaatcagacggatcgagctacggcagcaggag
gcacagcaaaatcagcatttgtag

DBGET integrated database retrieval system