KEGG   Brevibacillus brevis: BBR47_27580Help
Entry
BBR47_27580       CDS       T00879                                 

Definition
2-oxo acid dehydrogenase E2 component (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbe  Brevibacillus brevis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bbe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbe00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbe00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbe00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2847903..2849207
Genome map
AA seq 434 aa AA seqDB search
MVEFKLPDVGEGMHEGEIVKVLVRTGESVQQDQPLLEVQTDKVNAELSAPVTGIIRDIFI
AEGEIVEVGTTLLVIDAGTEVEVKTETKHPEKVVNPDKTVHFTPARADHRRSLATPYVRQ
LAREMKLDIELVTGTGAAGRVTEEDLRQFANRLQKSAPAKFPTSATGNERLLEASTAAIE
TEPIVQSKTGTATRAATSSQGGIERLPLKGIRKKIAEHMVKSVTIIPHVTSVDELEMDQL
RALRETLRPHAEKRNIKLTFLPFFIKALVIALKEFPTLNASIDERTNEILLKRFYHIGIA
TDTPEGLIVPVIKDADHKSIFQLAEEIDQLARLAREGKLTMEHITGGTFTISNVGPIGGL
QATPIINHPEVAIISLHKMEKRWVVREDEGVIRWMMNLSLSFDHRLIDGVTAVRFTNRIK
ELLEDPNLLFAEMV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggttgagttcaagcttccggatgtgggagaaggtatgcatgaaggagaaatcgtaaaa
gtactggttcgcacaggcgaatccgttcaacaggatcagccactactggaggtgcagaca
gacaaggtgaatgccgagttgtctgcgccagtgactggcatcattcgtgacattttcata
gcagaaggggaaatagtagaggtcggcacaacccttctcgtgatcgatgcaggtacagaa
gtggaagtaaagacggagacaaagcatccagaaaaggtcgtaaacccggataagaccgtc
cattttactccagctcgtgctgatcaccgccgctcattggccacgccgtacgttcggcag
ttggcgcgggaaatgaagctggatatcgagttggtcacaggtacaggagcagcgggacgt
gtgacggaagaggatttgcgccaattcgccaatcgattgcaaaaatcagcaccagctaag
tttccgacatcggccactggcaatgagcgcctgttggaggcaagtacagcagcgattgag
acggaaccgattgttcagtcgaaaacaggaaccgctactcgtgcagccacctcgtcgcag
ggaggtatcgaacggctaccgttaaaaggcatacggaaaaagattgccgagcatatggtg
aaatcagtcacaatcatcccgcatgtgacttctgtcgacgagctggagatggatcagctg
cgtgctttgcgcgaaacgttaaggccacatgcggaaaaacggaatattaagctgaccttc
ctcccgttctttatcaaagcgctggtcattgcactaaaggaattcccgacgctaaacgca
tcgattgacgaacgtacgaatgaaattttgctcaagcgcttttaccatatcggcattgca
acggatacgcctgagggcttgatcgtaccagtcatcaaggatgcagaccacaaatcgatt
tttcaactcgcggaagaaatcgatcaactggcacgcttggctcgcgaaggaaaattgacc
atggagcacattacaggtggcactttcacgatcagcaatgtagggccaatcgggggactg
caagcaacgccaatcattaatcacccggaagtagcgattatcagtttgcacaaaatggag
aaacgctgggtcgtgcgtgaggatgaaggcgttattcgctggatgatgaacctgtcactt
tcgtttgatcatcgcctgatcgatggcgtgacggcagtacgttttaccaaccggatcaag
gagctgctggaagatccgaatctattgtttgcggagatggtatag

DBGET integrated database retrieval system