KEGG   Brevibacillus brevis: BBR47_28110Help
Entry
BBR47_28110       CDS       T00879                                 

Gene name
melA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bbe  Brevibacillus brevis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbe00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bbe00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bbe00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2930501..2931802
Genome map
AA seq 433 aa AA seqDB search
MPKITFLGAGSTVFAKNVLGDCMHVSALEGSEFALYDIDPQRLKDSESMLNNLKESTGRE
VTVKAYTDRKEALRGAKYVINAVQIGGYDPCTITDFEIPKRYGLQQTIADTVGIGGIFRN
LRTIPVLLDFARDMEEVCPNAWFLNYTNPMAALTGTLLRFGGIKAVGLCHSVQVCAPYLL
KSLGMETDNLQYKIAGINHMAWLLEITRDGVDLYPEIKRRAAEKQKARHDDMVRFELMLR
FGYYVTESSEHNAEYHPYFIKGRYPELIERFHIPLDEYPRRCVEQINKWTAMREDLVNNK
QISHARTLEYASYIIEAMETNKPFTIGGNVLNTGRLISNLPEKACVEVPCLVDGNGVTPT
YVGELPEQLAALNRTNINTQLLTIEAAITRKKEHIYHAALLDPHTASELSIDDIVSLCDD
LIEAHGEWLPQFS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaatcacttttttaggagcgggaagtactgtttttgccaagaatgtattagga
gactgcatgcatgtttctgcgttagaaggctctgagtttgccctatacgatattgatccc
caaaggctaaaagactctgagagtatgttgaacaatttaaaggaaagtacaggtagagag
gtgacggtcaaagcctataccgaccgaaaggaagcattgcgcggagcgaaatacgtgata
aacgccgtacagatcggtggttatgacccttgtaccattaccgacttcgaaatccccaaa
cgttatggtctacaacaaacgattgcagacaccgtgggtattggtggtattttcagaaat
ttgagaacaataccagtattacttgattttgcacgtgatatggaggaagtttgcccgaat
gcctggtttctcaactatacgaatcccatggctgcattgacgggtacattgcttcgtttt
ggcgggattaaagcagtggggctttgccatagtgtccaagtatgcgcaccttatttacta
aagtcactaggaatggaaacagacaatcttcagtataaaattgcggggatcaaccatatg
gcatggttgctagagatcacgagagatggggtagacctgtatccggagataaaacggcgt
gcagcggaaaaacagaaggccagacacgatgacatggttcgctttgagctcatgcttcgc
tttggttactatgtgacagaatcctccgaacataatgcggagtaccacccatactttata
aaaggcagatatccagagctgatcgaacgctttcatattccgttggacgaatatccgaga
cgctgtgtagaacaaataaacaaatggacagccatgcgagaagacttggtgaacaacaag
caaatcagtcacgctcgcaccctagaatatgcatcatacatcatcgaagcaatggaaacg
aacaagccatttacgattggtggtaatgttttgaatactggaagactcatcagcaatcta
ccggaaaaggcttgtgtagaagtaccttgcctggtagatggaaacggtgttacccctacg
tatgttggggaacttcctgagcagttggccgctctcaatcgcacgaacatcaatacgcag
cttttgacaattgaagcagctattacaaggaaaaaggagcacatttatcatgcagcactg
ctcgatcctcataccgcttcagaattatccatcgatgacattgtgtctttatgcgatgat
ttaattgaagcccacggggagtggctcccgcaattttcataa

DBGET integrated database retrieval system