KEGG   Brevibacillus brevis: BBR47_28160Help
Entry
BBR47_28160       CDS       T00879                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bbe  Brevibacillus brevis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBR47_28160
  Lipid metabolism
   00561 Glycerolipid metabolism
    BBR47_28160
   00600 Sphingolipid metabolism
    BBR47_28160
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BBR47_28160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2935988..2937748
Genome map
AA seq 586 aa AA seqDB search
MVHHIEAYHDSVLRVKLQNECTDGDISYVHVVIESDEEISFPQVQLAWHYPAVNIQAYWH
PGSFRNKSLGVDWSKGFSSKGTVVAPVGCFLSSDGRNRLAIAYSNAIETVNFHMGIREED
GTIRCQITLFSEPSKPMKRYEGTIRIDQRDIPFEQAIQAISYWYESMDAYRPCMIPKAAT
FPMYSTWYSFHQELVDKEIEQQCRMAKEIGCDTVIVDDGWQTTDNQRGYAYCGDWEVAHQ
KIGNMKAHVQKVQAMGMKYILWYSMPFIGLHSKAWDTYKDKLLGYREHLQAGVLDPRYPE
VREYLISTYETALNEWGVDGFKLDFIDEFDLNKANDKALEKDGRRDFDSVQEAVECLLEG
IFARLHARKADVMIEFRQKYIGPFMRRFGNIFRVADCPNDAVTNRVGTIDLRLFSGNTAV
HSDMLMWSPEDTVENAALQLINVLFAVPQLSMRFEKLPPEHIEMTKFWLKFWRENRDVLL
FGELRAEAPELLYPNVQARNSSKVVMAVFGSPYVKVVEPGNKKLFIMNGTLHQELVLDVD
RELPNRVVEIYDCCGNLVSMAPLAVQKVPHRLKVKPSGLAILTCLK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggttcatcatatagaggcatatcatgactctgtgcttcgggtcaaattgcaaaacgaa
tgtactgacggtgacatctcctatgtacatgtcgtaatcgaatcagatgaggaaatttcg
tttccgcaggttcaactcgcatggcattaccccgcggtcaatatacaagcatactggcat
cctggcagttttcgcaacaaaagtctcggagtcgattggagtaaaggcttttcctccaaa
ggtacggttgttgcgcctgttggttgctttctcagttcagatggacgtaatcgcctcgct
attgcttattccaatgcaatcgagactgtcaactttcacatgggcatccgtgaagaggac
ggaacgattcgctgtcaaatcacgcttttttcagagccttccaaaccgatgaaaaggtat
gagggaaccattcgtattgatcaaagagacattccttttgaacaagcgattcaggccata
tcctattggtacgagagcatggatgcctatcggccatgtatgatacccaaagcggcaaca
ttcccgatgtattctacatggtattcttttcatcaagagctcgtagataaagagatcgaa
caacagtgcagaatggcaaaagagatcggatgcgacaccgtaatcgtggatgacggatgg
caaacaaccgataaccaaagaggatatgcctattgcggggattgggaggtcgcacatcaa
aagatcggcaacatgaaagcacatgtgcaaaaagttcaggctatgggaatgaaatacatc
ttgtggtatagcatgccttttatcggtttgcattcgaaagcgtgggatacctataaagat
aagctgctgggttatcgagagcatctgcaagcaggtgttttggacccaagatatccggaa
gtccgggaatacttgatttccacttatgaaactgctctgaatgaatggggcgtcgatggc
ttcaagctggattttatagatgagtttgatttgaacaaagcgaatgacaaagccctcgaa
aaagatgggagaagagattttgactccgttcaggaagcggttgaatgcttgcttgaagga
atcttcgcgcggttacacgccaggaaagctgatgtcatgattgaatttcgtcaaaagtat
atcggtccctttatgagaaggtttggaaacatatttcgggttgccgattgtccgaatgat
gccgttaccaatcgggtggggacgatcgatttgcggttgttctccggtaacacagctgtt
cactcagatatgttgatgtggagcccggaagatacggttgaaaatgcggccctacagctc
attaatgttttgtttgcggttccacagttatcgatgcgcttcgagaaattaccgccggag
catatcgaaatgacaaagttctggttgaagttttggagagaaaacagagacgtgctttta
tttggagagttacgtgcagaagctcccgagttactttatccgaatgttcaagcgcgaaat
tcatcgaaagtagtcatggcagtctttggtagcccatacgtgaaagtggttgagccaggc
aataaaaagctattcattatgaacgggacactacaccaagagctggttttggatgtagac
agagagttacctaacagagtagtagagatttatgattgttgcggaaacctggtgtctatg
gctccgttggcagttcagaaggtgccacatcgtctgaaggtaaaaccgtcgggattagcg
attcttacatgtttgaaatga

DBGET integrated database retrieval system