KEGG   Brevibacillus brevis: BBR47_28560Help
Entry
BBR47_28560       CDS       T00879                                 

Gene name
ysdC
Definition
(GenBank) peptidase M42 family protein
Organism
bbe  Brevibacillus brevis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
2982075..2983154
Genome map
AA seq 359 aa AA seqDB search
MNSWVKVLKELTEASGVPGQEQEVRELMHTYLEPLTEEVFTDNLGSIIGRKTGLANGPKI
MMMGHMDEVGFMVTRVMKDGFIAFQPLGGWWSQVMLAQRVNIKTGKGDIVGVIGSKPPHL
LSSEERKKVVEIERMYIDIGASDAEQAKELGIRPGDPIVPICPFTVMANDKMYMAKALDN
RGGCLTAIEVMKQLQETDHPNIVYSGATAQEEVGCRGAFTSTYMVQPDLFIALETGITFD
TPGSADSPNLPDIKLGGGPTIGLFDGSLVPNRKLRDLLFDTAEEEGIPYQYAALAGAGTD
AGAAHMVGKGAPSIVIAIPARYIHSHASILHHDDVENTVKLLTALVKKLDQKTVDWLKS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttgggtaaaggtactgaaagagctgacagaggcttccggagttcccggacaa
gaacaggaagtgcgagaattaatgcacacctatttggaaccgcttacagaagaagtgttc
acagataatctgggaagcataatcggtcggaaaacaggcctggccaatggaccgaaaatc
atgatgatgggccatatggatgaagtggggttcatggtaacgcgtgtcatgaaggatgga
ttcatcgccttccagccgcttggtggctggtggtcgcaggtgatgctggcacagcgcgtg
aacattaaaacaggcaaaggggatattgttggcgtaatcgggtcaaaaccgccacatctg
ctgtcttcggaagaacgaaagaaagtggttgaaatcgaacggatgtacatcgatatcgga
gcatccgatgcagaacaggcaaaggagctgggtattcgcccaggtgatccgattgtgccg
atctgccctttcacggtgatggcgaatgacaagatgtatatggcaaaagcgctcgataat
cgcggcggttgcctgacagccattgaagtaatgaaacagttgcaagaaacggatcacccc
aacatcgtatatagcggcgctactgcacaagaagaagtgggatgtcgcggcgcattcacg
agcacgtatatggtgcagccagatttatttattgcattggagacggggataacgtttgac
acgccgggaagcgccgactctcctaatttgcctgatatcaagcttggtggtgggcctacg
attggtctattcgacggctcgctcgtgcctaatcggaaattgcgtgatctgttatttgat
acggctgaagaggaaggcatcccgtatcaatatgctgctcttgcaggtgcgggtacggac
gcaggagctgctcatatggttggcaaaggggctccatccattgtcattgcaatccctgcg
cgttacattcacagtcacgcttcgattctccatcatgatgatgtggaaaatacggtgaaa
ttgctgacggctctcgtcaaaaagctggatcaaaaaacggttgattggctcaaatcgtag

DBGET integrated database retrieval system