KEGG   Brevibacillus brevis: BBR47_28560Help
Entry
BBR47_28560       CDS       T00879                                 

Gene name
ysdC
Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bbe  Brevibacillus brevis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBR47_28560 (ysdC)
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BBR47_28560 (ysdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2982075..2983154
Genome map
AA seq 359 aa AA seqDB search
MNSWVKVLKELTEASGVPGQEQEVRELMHTYLEPLTEEVFTDNLGSIIGRKTGLANGPKI
MMMGHMDEVGFMVTRVMKDGFIAFQPLGGWWSQVMLAQRVNIKTGKGDIVGVIGSKPPHL
LSSEERKKVVEIERMYIDIGASDAEQAKELGIRPGDPIVPICPFTVMANDKMYMAKALDN
RGGCLTAIEVMKQLQETDHPNIVYSGATAQEEVGCRGAFTSTYMVQPDLFIALETGITFD
TPGSADSPNLPDIKLGGGPTIGLFDGSLVPNRKLRDLLFDTAEEEGIPYQYAALAGAGTD
AGAAHMVGKGAPSIVIAIPARYIHSHASILHHDDVENTVKLLTALVKKLDQKTVDWLKS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttgggtaaaggtactgaaagagctgacagaggcttccggagttcccggacaa
gaacaggaagtgcgagaattaatgcacacctatttggaaccgcttacagaagaagtgttc
acagataatctgggaagcataatcggtcggaaaacaggcctggccaatggaccgaaaatc
atgatgatgggccatatggatgaagtggggttcatggtaacgcgtgtcatgaaggatgga
ttcatcgccttccagccgcttggtggctggtggtcgcaggtgatgctggcacagcgcgtg
aacattaaaacaggcaaaggggatattgttggcgtaatcgggtcaaaaccgccacatctg
ctgtcttcggaagaacgaaagaaagtggttgaaatcgaacggatgtacatcgatatcgga
gcatccgatgcagaacaggcaaaggagctgggtattcgcccaggtgatccgattgtgccg
atctgccctttcacggtgatggcgaatgacaagatgtatatggcaaaagcgctcgataat
cgcggcggttgcctgacagccattgaagtaatgaaacagttgcaagaaacggatcacccc
aacatcgtatatagcggcgctactgcacaagaagaagtgggatgtcgcggcgcattcacg
agcacgtatatggtgcagccagatttatttattgcattggagacggggataacgtttgac
acgccgggaagcgccgactctcctaatttgcctgatatcaagcttggtggtgggcctacg
attggtctattcgacggctcgctcgtgcctaatcggaaattgcgtgatctgttatttgat
acggctgaagaggaaggcatcccgtatcaatatgctgctcttgcaggtgcgggtacggac
gcaggagctgctcatatggttggcaaaggggctccatccattgtcattgcaatccctgcg
cgttacattcacagtcacgcttcgattctccatcatgatgatgtggaaaatacggtgaaa
ttgctgacggctctcgtcaaaaagctggatcaaaaaacggttgattggctcaaatcgtag

DBGET integrated database retrieval system