KEGG   Brevibacillus brevis: BBR47_29770Help
Entry
BBR47_29770       CDS       T00879                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bbe  Brevibacillus brevis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BBR47_29770
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBR47_29770
   00650 Butanoate metabolism
    BBR47_29770
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BBR47_29770
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBR47_29770
   00622 Xylene degradation
    BBR47_29770
   00621 Dioxin degradation
    BBR47_29770
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BBR47_29770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3160722..3161609
Genome map
AA seq 295 aa AA seqDB search
MRKVKVAILGSGNIGTDLMIKLGRSPILELTSMIGIDPDSDGLRRAKAAGYYVFDGGLQP
FLESGAELADIVFDATSAKAHILHAKALREAGKFAIDLTPAAVGPYVVPSVNLGAHLNET
NINLITCGGQATIPIVHAIGSVSPVSYAEIVATISSKSAGPGTRSNIDEFTETTAQGIEA
IGGAKKGKAIIILNPAEPPILMRDTVYAVVDEGADRQAIVKAIHQTVAYIQSYVPGYRLR
SEPIFDENKITVFFEVEGAGNYLPTYSGNLDIMTATAVKVAEEYAKYVVGIGTSM
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagtaaaagtagccatactcggttcgggtaacatcgggacagacctgatgatc
aagctgggaaggtcgccaattcttgaactgacgtccatgattggaatcgatcctgattcg
gatggtctgcgtagagcaaaggctgctggatactacgtatttgacggcggattacaaccg
tttttggaaagcggtgcggaacttgcggatatcgtctttgacgctacgtcagccaaagca
catattctgcatgccaaggcgctccgggaggctggaaagttcgccatcgatctgacgcct
gctgctgtggggccctacgtagtaccatctgtgaatctcggtgcgcatttgaatgaaacg
aacatcaatctgatcacatgcggcggccaggctacgattccgatcgttcatgcgataggg
agtgtgagtccagtcagttatgcagagatcgtggccactatttccagtaaaagcgcgggt
cctggcacacgttccaacatcgatgaatttacagagacgaccgcccaaggtatcgaagcg
atcggcggagcgaagaaaggcaaggcgatcatcatcctgaatccggcggagccaccgatc
ctgatgagggatacggtctatgccgtagtggacgaaggtgcggaccgacaggcgatcgtg
aaggctattcaccagaccgttgcctatattcaatcatacgttcctggttaccgcctgcgc
tcagaaccgatctttgatgaaaacaaaatcaccgttttttttgaagtggagggcgcgggt
aactacctccctacttattcaggcaatctggatatcatgacggcgacagcggtaaaggta
gcagaggagtatgccaagtatgttgtcggcatcggcacgagtatgtag

DBGET integrated database retrieval system