KEGG   Brevibacillus brevis: BBR47_32960Help
Entry
BBR47_32960       CDS       T00879                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbe  Brevibacillus brevis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bbe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbe00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbe00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbe00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3511993..3513387)
Genome map
AA seq 464 aa AA seqDB search
MSRFTFRLPELGEGIHEGEIVKWHVQPGDSVEEDQVIMEVQNDKAVVEVPSPVKGKVIEL
KVTEGTVSVVGDPLIEFDVEGEIPNLPDHGHGDSHAAEAAPAPQAADKMEPGCDIGSQVS
ANANQTLETPMAQATATAVAAPIDRKHVLATPSVRKYAREKGVQLANVPGTGKLGRITRE
DVDRFVSGGAAAPTPTAQAAAAPVATEAPAAATGVAQAAAAPTVHHAPTAGELEERVPMK
GMRKAIAKAMVKSAYTAPHVTIFDEVDVTALVAMRKDAKPLAEERGVKLTYLPMIVKAVV
AGLKKFPELNASIDDEKQEIIFKKYYNIGIATSTEEGLLVPVVKSADSKSIFQIAGEIGE
LAKKARDRKATADELKGSTFSITNIGSAGGMFFTPIINYPEVAILGVGRISEKPIVKNGE
IAVGQMLHLSLSFDHRLVDGEPAQRFVNYVKQLLENPTLLVMEG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgttttacattcagactcccggagctcggcgagggtatccatgaaggcgaaatc
gtcaaatggcacgtacagccaggagattccgtagaagaagaccaagtaatcatggaagta
caaaatgacaaggcggttgtagaagtaccgtcgcctgttaaagggaaagttatcgagctg
aaagtaaccgagggtacggtttccgtagtcggcgatccactgatcgagtttgacgtagaa
ggcgaaattccgaacctgccagaccatggtcatggcgattcccacgctgctgaagcggca
ccagcgcctcaagctgcagacaaaatggagccaggctgcgacatcggttcccaagtgagc
gcaaatgcgaatcaaactttggaaacgccaatggcacaagcaactgcaacagcagtagcg
gcaccaattgaccgtaagcatgtgctggctacaccttccgttcgtaaatacgctcgcgaa
aaaggcgttcaattggctaacgtacctggtacaggcaaattgggtcgcatcacacgcgaa
gacgtagatcgcttcgtatctggcggagcagcagcaccaacaccaactgcacaagcagcg
gcagctccagtagctactgaagctcctgcagcagctacaggtgtagcacaagcagcagcg
gctccaactgttcaccacgcacctacagcaggcgagctggaagagcgcgttccgatgaaa
ggtatgcgtaaagcaatcgcgaaagcaatggtgaaatctgcttacacagcaccacacgtt
accatcttcgacgaagtggatgttacagcgcttgtcgctatgcgtaaagatgcgaagcca
cttgctgaagagcgcggtgtgaagctgacttacttgcctatgatcgtgaaagcagttgta
gctggtctgaagaaattcccagaactcaacgcttctatcgacgatgagaaacaagaaatc
atcttcaaaaagtactacaacatcggtatcgctacctcgacagaagaaggcttgctcgtt
ccagttgtgaaatccgctgacagcaaatccatcttccaaatcgcaggcgaaatcggcgag
ctggcgaagaaagcacgcgaccgcaaagcgactgctgacgagctgaaaggttctactttc
agcatcacaaacatcggttctgcgggtggtatgttcttcacgcctatcattaactatcca
gaagtagctattctgggtgttggccgcattagcgaaaaaccgattgtgaaaaatggagaa
atcgcggtaggtcaaatgttgcacctgtccttgagctttgaccaccgtttggttgatggc
gaacctgcacagcgtttcgtcaactacgtgaagcagctccttgaaaacccaacgctgctc
gtcatggagggataa

DBGET integrated database retrieval system