KEGG   Brevibacillus brevis: BBR47_34950Help
Entry
BBR47_34950       CDS       T00879                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00020  Citrate cycle (TCA cycle)
bbe00640  Propanoate metabolism
bbe00660  C5-Branched dibasic acid metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
Module
bbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBR47_34950 (sucC)
   00640 Propanoate metabolism
    BBR47_34950 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BBR47_34950 (sucC)
Enzymes [BR:bbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BBR47_34950 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAH44472
NITE: BBR47_34950
UniProt: C0ZFB3
Position
complement(3702758..3703918)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEILKQYGVKVPEGRVAFTVEEAVEAAKELGTQVNVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYASEILGKVLVTHQTGPEGKEVKRLLIEQGCDIKKEYYVGVVVDRATGS
VVMMASEEGGMDIEEVAANNPEKIFKEVVDPVTGLNGFQARRLAYAINIPKELINKAAKF
MMSLYQAFVDKDASIAEINPLVVTGDGEVMALDAKLNFDSNALYRHPDIVALRDLDEEDE
KEIEASKFDLSYIALDGNIGCMVNGAGLAMATMDIVKFYGGDPANFLDVGGGATEEKVTE
AFKIILRDEKVKGIFVNIFGGIMKCDVIANGVVNAAKQIKLDKPLVVRLEGTNVDLGKKI
LNESGLNIVAAESMADGAEKIVSLVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgagtatcaaggtaaagagatacttaagcagtacggtgtaaaagttcct
gaaggacgcgtagctttcacagtggaagaagctgttgaagcagcaaaagaactgggcacc
caagtaaacgtagtaaaagcgcaaattcacgctggtggccgtggtaaggctggcggtgta
aaggttgcaaaaaatcttgatgaagttcgtacatatgccagcgagattcttggcaaagta
ctcgttactcatcaaacaggaccagaaggtaaagaagttaagcgccttctgatcgagcaa
ggctgcgacatcaagaaagaatactacgttggtgtagttgttgaccgtgctactggaagt
gttgtaatgatggcttccgaagaaggcggcatggacatcgaggaagtagcagcaaacaat
ccagaaaaaatcttcaaagaagtagttgatccagtaacaggtctgaatggcttccaagct
cgtcgcctggcttacgcaatcaacattccaaaagaattgattaacaaagctgccaagttc
atgatgagcttgtaccaagctttcgttgataaagatgcttctatcgctgaaatcaaccca
ctggttgtaactggcgacggtgaagtaatggcactggatgcaaaactgaacttcgacagc
aacgctctctatcgtcaccctgacatcgtagctctgcgcgatttggatgaagaagatgag
aaagaaatcgaagcttccaagttcgatctgtcctacatcgcacttgatggtaacatcggt
tgcatggtaaacggtgcaggtctggcgatggcaacaatggacatcgtgaaattctacggt
ggagacccagctaacttccttgacgttggtggcggagctactgaagagaaagtaacggaa
gcgtttaaaattattctccgtgacgaaaaagtaaaaggtattttcgtcaacatctttggc
ggcatcatgaaatgcgacgttatcgcaaacggcgtagtgaatgcagcaaaacaaatcaaa
ttggacaaacctctcgttgtacgtctcgaaggtacaaacgtagatttgggtaagaaaatc
cttaatgagtccggtttgaacattgtagctgcagaatctatggcggatggcgctgagaaa
atcgtatccttggtgaagtaa

DBGET integrated database retrieval system