KEGG   Brevibacillus brevis: BBR47_37860Help
Entry
BBR47_37860       CDS       T00879                                 

Definition
hypothetical protein
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
bbe  Brevibacillus brevis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBR47_37860
Enzymes [BR:bbe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     BBR47_37860
Glycosyltransferases [BR:bbe01003]
 Polysaccharide
  Storage polysaccharide
   BBR47_37860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3967876..3970713)
Genome map
AA seq 945 aa AA seqDB search
MHKGYLSLVLHAHLPYVRHGDRDDRLEERWVYEAMLECYLPLLMVFDKLLSDGIAFRMTL
AISPTLLSMLDDDLIVTRFRTHLAKTVELAGKEVKRTTGQPQENRIAKMYVERFRTIIAY
CRKWDFQLIKAFRHIADSGCLELITCAATHSFLPYVETEEAIRAQLLVGIDTHERILGRR
PKGIWLPECGYTPGLDRLLKEAGLRYFFVDSHTIEHATPLPRRGLLAPLFTPHDVAAFAR
DEVASRQVWSSIDGYPGDYDYREYYRDIGFDREMSYIEPYIHPEGIRVHTGLKYYRITGK
QGDKDWYEPSWAREKAASHAGHFLYHRERQVEEASQWMDRKPLVVATYDAELFGHWWFEG
PQFLDFLMRKTVCDSKEVKLMTPSEYLEEYPEQDRGHLPMSTWGRNGYGEVWLNENNGWI
YRHLHQAERELITAIITYSEKKGDQLALRCLKQAARELMLAQSSDWAFILDGQTVTRYAV
QRVHDHLVRMRALLAMYREHRLDEEAITQAEADFPIFPDVDITFYLPKQTHRVNVSRQLV
AAAQDQSSTKTVLMLAWEFPPHVVGGLGRAVYDLARHLAQQGIVVHVLTRATDSCAVEEM
MEGVHVHRLPTYIPSEQADFLAWVFQLNLAMVDAIYQLWSLGVRPDVIHAHDWLVSWAAI
ELKQRYSLPLVSTIHALEHGRHQGIHTPLQQRIHECERTLTQSSDAIIVCSKYMESEVKR
LFGTPSSHLRVIHNGVDLIPLTEVNREQLRQELAIGDGPVLFFVGRLVQEKGVHLLLEAM
ARLRAEFPHARLLIAGRGPMQDEWKLLVHQMGLSEQVRFLGFVDDGRRDELFALADVAVF
PSLYEPFGIVALEAMALGTPVLVADTGGLREIVRHGENGAMMYTGDPESLTNQLRWLLRD
PDQRHQLAQTAMQDVKQFYNWTLLASQTIDLYRSLSVPAEIGMTT
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaaaggttatctctccctcgtgttgcatgcccatctgccttatgttcgacacggg
gatcgggacgatcgcctggaagagcgctgggtgtatgaagccatgctggaatgctatctt
cctttgctcatggttttcgacaagctcctctcagacggcatcgcttttcgcatgaccctt
gctatttcaccgacattactttccatgctggatgatgatctgatcgtgacgcgttttcgc
acacacctagcgaaaaccgtggaattggctgggaaggaagtcaaacgaaccacaggtcaa
cctcaagaaaaccgtatcgccaaaatgtatgtggagcgttttcgaacgatcattgcctac
tgccgcaagtgggattttcaactgatcaaggcctttaggcatatcgcggacagtggatgc
ctcgaactcatcacttgcgcagccacgcactcttttttgccctatgtggaaacagaagag
gcgattcgggcacagcttctggtagggatcgatacgcatgagcggattctgggaagacgt
ccgaagggaatttggttgccagagtgcgggtatacacctggactggatcgcttgctgaaa
gaggcagggcttcggtatttctttgtagacagtcacacgatagagcatgcgacgccttta
cctcgcagagggttgctggctcccttgttcacgccgcatgatgtggctgcctttgctcgt
gatgaagtggcctcccgccaggtatggagctcgatcgatggttatccaggggactatgac
taccgtgaatactaccgggatatcggatttgacagggagatgagctacatcgagccgtac
atccatcctgaaggcattcgcgtgcataccggtttgaaatattatcggatcaccggaaaa
caaggggataaagactggtatgagccaagctgggcgcgcgaaaaagcagcgtcacatgcg
ggacatttcttgtatcaccgagagcgtcaagtggaggaagccagtcaatggatggaccgc
aagccattggtcgtcgccacttatgatgcggagctgtttggtcattggtggttcgagggt
ccgcagtttttggattttctcatgcgcaaaacggtgtgtgattcaaaagaagtgaaatta
atgacaccatctgaatatttggaggagtatccagagcaggatcgcggtcacttgccgatg
tcaacatgggggagaaatggctacggagaagtctggctgaacgagaacaatggctggata
tacaggcatctgcatcaagcggagcgggaattgatcacagcgattattacctattctgaa
aagaaaggagatcagcttgcgttacggtgcctcaagcaggctgcacgggaattgatgctg
gcccaaagcagtgattgggcgtttattttagacggtcaaacggtcactcggtatgcggtg
caacgcgttcatgaccatttggttcgcatgcgggctctcttggcgatgtatcgggagcat
cgactggatgaagaggcaattacacaagcagaagctgactttccgatctttcctgacgtg
gatatcacgttctatttgcctaaacaaacgcatagagtgaacgtatcgcgtcaattggta
gcggctgcgcaagatcagtcttcgacaaaaacagttttaatgcttgcatgggaatttccc
cctcatgtagtaggggggctaggtcgggctgtctacgatctcgccaggcatcttgcccag
caaggaatcgtggtgcatgtgctgacacgtgcgacagattcatgcgccgtagaggagatg
atggaaggggttcacgtacaccgtttgcctacgtacattccttctgaacaagccgacttt
ctggcatgggtgtttcaactgaatttggcgatggtcgatgctatctatcagctctggtca
ctcggggtgcgaccagatgtcatccacgctcacgattggctagttagctgggctgcaatc
gaactgaaacagaggtactctcttccgctcgtcagcacgattcatgctttggaacatggt
cggcatcaaggtattcatacaccgttgcagcaaaggatccatgagtgtgaacgtacgcta
acacaaagctctgacgcaataatcgtttgcagcaagtatatggagtcggaagtcaagcgc
ctgttcggaacaccctcctcccatttacgtgtcattcacaatggtgtcgatctcattccc
ctaacggaggtaaatcgtgaacagcttcgacaggaattggcgataggggatggtcctgtt
ctcttttttgtagggcgcttggttcaggaaaaaggtgttcacctcttgttagaagctatg
gcaaggctacgcgctgagtttccgcatgcgaggttgctcatagctggcagaggaccgatg
caagacgagtggaagctattggttcatcagatgggactttctgaacaggtccgcttcttg
ggcttcgtagacgatggaaggcgagatgagctgttcgccctggctgatgtggcagtattc
ccgagcttgtatgagccttttggaattgttgcgctggaagcgatggctctagggactcct
gttctggttgcggatacgggagggctgcgagagatcgttcgccacggcgaaaacggcgcc
atgatgtacacaggcgaccctgaatccttgacgaatcaactccgctggctactgcgcgac
cctgatcagcggcatcaactggcccaaacggccatgcaagatgttaaacagttttataac
tggacacttctggctagtcaaaccatcgatctataccgttcacttagcgtacctgcggaa
atcggcatgacaacctag

DBGET integrated database retrieval system