KEGG   Brevibacillus brevis: BBR47_39830Help
Entry
BBR47_39830       CDS       T00879                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bbe  Brevibacillus brevis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBR47_39830
Enzymes [BR:bbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BBR47_39830
Peptidases [BR:bbe01002]
 Cysteine Peptidases
  Family C44
   BBR47_39830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4161887..4163704)
Genome map
AA seq 605 aa AA seqDB search
MCGIVGWLDWDDDLSSQHAILQKMAQAIQHRGPDEEGYWLSPRAAIAHRRLIVIDPEGGK
QPMIYREGDQTCVLSFNGEIYNYLELRRQLELLGHTFQTNSDTEVLLHAFLEWREECVRH
LNGIFAFAIWDEKNHRMFLARDHLGVKPLFYCQRGSSFLFGSELKALLAHPKVKPEVEAD
GLADIIGLGPARTPGFGIFRNVNEVRAGHCVTVTKDQIRTRPYWKLESKVHTDDLDTTTE
RIRALLQDTVTRQLISDLPLVSMLSGGLDSSGLVALAAEELRKKGQTLQTYSVDFVDNDQ
HFEEGLLHISLDAPWAKKVSEHVQTRHQEITFNAQDLITHFHMPLRARDLPGLGETDTSL
YLFCREMKKKATVSLSGESADEVFNGYPWFQKEKFLNSGKFPWMEHDGWSSFLNEEAIEK
IRPQEYLRRRYEEGIAEVHPLEGETALEAQQRKMSYLFITRFLPLLLDRKDRMSMYTGFE
VRVPYCDYRLVEYLWNVPWKVKNIDQIEKGLLRRAFKGYLPQEVLYRNKSAYPMTYHPEY
YHAILDHMKQILANPNSPLLPLINKSVIQFVLDGKAPMNLAQSTKLIEYLVQINMWLEEY
KISIR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtgggatggcttgattgggatgacgatttgtcatcccagcatgctatt
ttgcagaaaatggctcaagcgatccagcatcgcgggccagacgaagaggggtattggttg
tcccctcgggcagcaattgcgcatcggcgcctgattgtgatcgacccagaaggtggcaag
cagcccatgatctaccgagaaggagatcagacatgtgtcttatcgttcaatggcgaaatc
tacaattatttggagctgcgccgccagttagagctgcttggacacacttttcaaaccaat
tctgacacggaagtattactgcacgcttttttggaatggagagaggaatgtgtccgtcat
ctcaatggaatttttgcattcgccatttgggacgaaaaaaatcatcgcatgtttttagca
cgtgaccacttgggtgtaaaaccattgttttattgtcaacgtgggagctcgttcttgttc
ggctctgaactgaaagccttgcttgcccatccaaaagtgaagcctgaagttgaagcggat
gggttagcagatattatcggactcggtccggcgagaacgcctggatttggtattttccgc
aatgtaaatgaggttcgagctggacattgtgtaacagttacaaaggatcaaatcaggaca
aggccatactggaaactggagagcaaggtgcataccgatgatttggatacaacgacagaa
aggatacgtgccctgttacaagacacggtaacgcgtcagttaatctctgacctgccattg
gttagtatgctgtctggcggtttggactctagtggcctggtcgctttagccgctgaagag
cttcgtaaaaaagggcagacgttgcaaacctattcggtagattttgttgacaatgatcag
cattttgaagaaggcttgctgcacattagcttggatgcgccatgggcaaaaaaagtctca
gagcatgtacaaacgagacatcaagagattaccttcaacgctcaagatctgatcactcat
tttcatatgccgttgcgagcgcgtgatctcccgggattaggggagacagatacctcgctc
tatttgttttgccgggaaatgaagaaaaaagcgaccgtctcgctatcaggtgaatcggca
gacgaagtgtttaacgggtatccttggtttcaaaaggagaaattcttgaattcaggcaaa
ttcccttggatggagcatgacgggtggagttcctttttaaatgaagaagccatcgagaag
attcgcccacaagaataccttcgcaggcggtatgaggaagggattgcagaggtgcaccct
ttggaaggggagacagctctggaagctcaacaacgcaaaatgtcgtacctttttatcact
cgctttctcccgctgctattggatcgcaaggatcgaatgagcatgtatacggggtttgaa
gtacgtgttccctattgtgattaccgcttggttgaatatttatggaatgtcccatggaaa
gtaaaaaatattgatcaaatcgaaaaaggcttgcttcgcagagcgttcaaaggctatttg
ccgcaggaagtattgtaccgcaataaaagcgcatatccgatgacctatcacccagagtat
taccatgcgattttggaccatatgaagcaaattctggcgaatcccaattcgcctttatta
cccttgattaataagtctgtgatccaatttgtactggatggtaaagcccctatgaatctc
gctcaatcaaccaaactgatcgaatacctcgtccaaataaatatgtggttagaggaatac
aagatttccattcgatag

DBGET integrated database retrieval system