KEGG   Brevibacillus brevis: BBR47_43670Help
Entry
BBR47_43670       CDS       T00879                                 

Gene name
ytjP
Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbe  Brevibacillus brevis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bbe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4615838..4617274)
Genome map
AA seq 478 aa AA seqDB search
MTSINWLEETNKRKEELIATTQQFLQIKSVLDPESAREGSPFGEGIRQALDFALGVCEKA
GMTTKDVRGYAGHAEFGQGEELIGILSHVDVVPEGDGWSTPPYAAEIVDGRLVARGAIDD
KGPTMAAIFAAKIVMELGLPLSKRVRFIFGTDEESSWQCVNTYFETEEMPTMGFTPDADF
PLIYAEKGLTDLSLRQTLASFQSLGIPAAENVEAKLVSLQAGLRMNMVPDKAVATLVPIG
LNSEAIAQNYRQHLDATGLKGKAEVQDGLVVLHMEGVSVHGMDPSKGVNAGTELIHFLRT
LSLDERGAVFVGLADRYLHKQHYGEAIGIAHNDEEMGALTVNTGVIEYDEKQDALFRLNI
RYPHSVAFEKWSAVLAERFSEGAFTLEVAEHLTPHRVDPNHPLVTTLQRVYTEQTGEEAG
IIAIGGATYGRSLDVGVAFGPLFPGRPDSAHQRDEYIFVDDLIKATAIYAQAIYELAK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcattaattggctagaagaaacaaataaacgcaaggaagaactcattgcgacg
acgcaacaatttttgcaaataaaaagcgtactcgaccccgagtccgcgcgggaaggttcc
cctttcggagaagggattcggcaagcgcttgactttgcgctaggcgtatgtgaaaaggca
ggcatgacaactaaagacgtccgcgggtatgcagggcacgctgaattcggacaaggcgag
gaattgatcggcattctgagccatgtcgatgtcgtaccggaaggcgatggctggagtaca
ccaccgtatgcggctgagatcgtggatggacgcttggtggcacgtggtgcgattgatgac
aagggaccgacgatggcggccattttcgccgcgaagatcgtgatggagcttggattgccg
ctgtcgaagcgcgtgcgctttattttcggtacggatgaagaatcgagctggcaatgtgtg
aacacgtattttgaaacggaagaaatgccgacgatgggctttacgccagatgccgatttc
ccgctgatctatgcggagaaaggcttgactgacctgtcattgcgccagacgctagcatcc
ttccaaagcctaggaatacctgctgcggaaaatgtggaggcaaagctcgtttccttacag
gctggcttgcggatgaacatggttccagacaaggctgtagcaacgcttgtgccaatcggc
ttgaatagtgaggcgattgcacaaaattatcgtcagcatttggacgcgactggcttaaaa
ggcaaggcggaggtgcaggatggcctcgttgtgctgcacatggagggcgtctcggttcac
ggaatggacccgagcaaaggtgtcaacgcgggtaccgagctcattcactttttgcgcacc
ttgtccttggatgaacggggagcagtattcgtaggcttggctgatcgttacttgcacaag
cagcattatggggaagcgatcggcatcgcgcataatgatgaagaaatgggcgcgctcaca
gtgaacacaggtgtgatcgagtatgacgaaaagcaggatgcgcttttccgtctgaatatc
cgttacccacattctgttgccttcgaaaaatggtcggcggttctggctgaacgattcagt
gaaggagcatttacgctcgaagtggcagagcatctgacaccgcaccgcgtcgacccgaat
catcctttggtgacgacactgcaacgcgtgtatacagaacaaacgggtgaggaagctggc
atcattgcaattggcggtgctacctacggccgttcgttggatgttggggtggcattcgga
ccgcttttcccaggacgacctgacagtgctcaccagcgagatgaatatattttcgtggat
gacttgatcaaagcgacagcgatttacgcgcaagcgatctatgaattagcgaagtag

DBGET integrated database retrieval system