KEGG   Brevibacillus brevis: BBR47_43670Help
Entry
BBR47_43670       CDS       T00879                                 

Gene name
ytjP
Definition
(GenBank) putative peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00300  Lysine biosynthesis
bbe01100  Metabolic pathways
bbe01120  Microbial metabolism in diverse environments
bbe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BBR47_43670 (ytjP)
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BBR47_43670 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAH45344
NITE: BBR47_43670
UniProt: C0ZI70
Position
complement(4615838..4617274)
Genome map
AA seq 478 aa AA seqDB search
MTSINWLEETNKRKEELIATTQQFLQIKSVLDPESAREGSPFGEGIRQALDFALGVCEKA
GMTTKDVRGYAGHAEFGQGEELIGILSHVDVVPEGDGWSTPPYAAEIVDGRLVARGAIDD
KGPTMAAIFAAKIVMELGLPLSKRVRFIFGTDEESSWQCVNTYFETEEMPTMGFTPDADF
PLIYAEKGLTDLSLRQTLASFQSLGIPAAENVEAKLVSLQAGLRMNMVPDKAVATLVPIG
LNSEAIAQNYRQHLDATGLKGKAEVQDGLVVLHMEGVSVHGMDPSKGVNAGTELIHFLRT
LSLDERGAVFVGLADRYLHKQHYGEAIGIAHNDEEMGALTVNTGVIEYDEKQDALFRLNI
RYPHSVAFEKWSAVLAERFSEGAFTLEVAEHLTPHRVDPNHPLVTTLQRVYTEQTGEEAG
IIAIGGATYGRSLDVGVAFGPLFPGRPDSAHQRDEYIFVDDLIKATAIYAQAIYELAK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcattaattggctagaagaaacaaataaacgcaaggaagaactcattgcgacg
acgcaacaatttttgcaaataaaaagcgtactcgaccccgagtccgcgcgggaaggttcc
cctttcggagaagggattcggcaagcgcttgactttgcgctaggcgtatgtgaaaaggca
ggcatgacaactaaagacgtccgcgggtatgcagggcacgctgaattcggacaaggcgag
gaattgatcggcattctgagccatgtcgatgtcgtaccggaaggcgatggctggagtaca
ccaccgtatgcggctgagatcgtggatggacgcttggtggcacgtggtgcgattgatgac
aagggaccgacgatggcggccattttcgccgcgaagatcgtgatggagcttggattgccg
ctgtcgaagcgcgtgcgctttattttcggtacggatgaagaatcgagctggcaatgtgtg
aacacgtattttgaaacggaagaaatgccgacgatgggctttacgccagatgccgatttc
ccgctgatctatgcggagaaaggcttgactgacctgtcattgcgccagacgctagcatcc
ttccaaagcctaggaatacctgctgcggaaaatgtggaggcaaagctcgtttccttacag
gctggcttgcggatgaacatggttccagacaaggctgtagcaacgcttgtgccaatcggc
ttgaatagtgaggcgattgcacaaaattatcgtcagcatttggacgcgactggcttaaaa
ggcaaggcggaggtgcaggatggcctcgttgtgctgcacatggagggcgtctcggttcac
ggaatggacccgagcaaaggtgtcaacgcgggtaccgagctcattcactttttgcgcacc
ttgtccttggatgaacggggagcagtattcgtaggcttggctgatcgttacttgcacaag
cagcattatggggaagcgatcggcatcgcgcataatgatgaagaaatgggcgcgctcaca
gtgaacacaggtgtgatcgagtatgacgaaaagcaggatgcgcttttccgtctgaatatc
cgttacccacattctgttgccttcgaaaaatggtcggcggttctggctgaacgattcagt
gaaggagcatttacgctcgaagtggcagagcatctgacaccgcaccgcgtcgacccgaat
catcctttggtgacgacactgcaacgcgtgtatacagaacaaacgggtgaggaagctggc
atcattgcaattggcggtgctacctacggccgttcgttggatgttggggtggcattcgga
ccgcttttcccaggacgacctgacagtgctcaccagcgagatgaatatattttcgtggat
gacttgatcaaagcgacagcgatttacgcgcaagcgatctatgaattagcgaagtag

DBGET integrated database retrieval system