KEGG   Brevibacillus brevis: BBR47_43870Help
Entry
BBR47_43870       CDS       T00879                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00670  One carbon pool by folate
bbe00790  Folate biosynthesis
bbe01100  Metabolic pathways
Module
bbe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBR47_43870 (folA)
   00670 One carbon pool by folate
    BBR47_43870 (folA)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BBR47_43870 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BAH45364
NITE: BBR47_43870
UniProt: C0ZI90
Position
complement(4638381..4638857)
Genome map
AA seq 158 aa AA seqDB search
MISLIVAYARNQVIGKDGDMPWHLPADLKNVKELTTGKTIVMGRKTFESIGKPLPNRRNV
VLTRSQDFHPEGVDVVHTKEEVLAMGDVIIFGGSEIYRQFLDVVDRLYITEIDLETEGDT
FFPAWDRDAYTLVDKREGIVDEKNVHPHAFYVYERKNS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcctgattgttgcctatgcccgcaaccaagtcatcggaaaagatggcgacatg
ccgtggcaccttcctgccgacttgaaaaatgtgaaggaattaacgacaggcaaaacgatt
gtaatgggacgcaaaacgttcgaatcgatcggcaagccgctgcctaaccgcagaaatgtc
gttttgacgcgcagtcaggactttcatcctgaaggtgtagatgtcgttcatacgaaggaa
gaagttctcgccatgggtgatgtcatcatctttggcggctcggaaatttatcgccagttc
ctcgatgtcgttgatcgtttgtacattactgagatcgatttggaaacagagggagatacg
tttttcccggcatgggaccgtgatgcttacaccttggtggacaagcgtgagggtatcgtg
gatgagaagaacgttcatccgcatgcgttttacgtgtatgagcggaaaaatagctga

DBGET integrated database retrieval system