KEGG   Brevibacillus brevis: BBR47_47050Help
Entry
BBR47_47050       CDS       T00879                                 

Gene name
nagA
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbe  Brevibacillus brevis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBR47_47050 (nagA)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BBR47_47050 (nagA)
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BBR47_47050 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4971144..4972757)
Genome map
AA seq 537 aa AA seqDB search
MQAEHMTVEQKVGQLLMIGYPTLDIPEEMEVWIKQKQIGSVILFSRNIGTPEETYQRVQK
LQSWAYESWHPYPLLVGTDQENGVVSRLQKGATRFPGAMALGATGNLDQAKRIYEATGEE
LRAAGISVNFAPTVDVNNNPDNPVIGVRSFGEAPEQVARFGEAAIQGLLASGVIPAIKHF
PGHGDTSIDSHEAVPVLGHDRTRLDQVELIPFQRSIAAGVPMVMVGHISLPSMDESGSPA
TYSKEIVTGILRESLGFDGVAITDCMEMAAIAGTIGVAEAAVRSVQAGIDLVLVSHTHEV
QQKTYDRLVAAIHSGELSEERVNEAVNRVLQLKKRFLSWEQCLRAKGPSFDRVQHADMAK
SALAQAITLVKNQHQLLPLQRSTQPLGVIFLGLANLTLAEDGQAASGDLVEPLRKYREVE
YYMMSTLNPTEDEGEMAAHVMSATEQIVVFTYNAHIFKGQSLLVNRLIQQGKKVVAVALR
NPYDLLVMPEVDAYLAVYDHTYQAIELVANILFGERKAAGHLPVSLFPSEKKQHGVG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgaacatatgacggtggaacagaaggttgggcaactgctgatgatcggttac
cctacgctggatattcccgaagaaatggaagtgtggatcaaacaaaaacagattggcagc
gtgattctttttagccgcaatatcgggacaccggaggagacttatcaacgtgtacagaag
ctccagagctgggcgtatgagtcttggcatccctatccgctgttggtcgggactgatcag
gaaaatggcgtggtttcccgtctgcaaaaaggggcgacgcgcttcccaggagcgatggct
ttgggggcaacaggcaatctcgatcaagccaagcgcatctacgaggcaacaggtgaggag
ctacgtgcagcagggatttcagtcaatttcgccccgacagtcgatgtgaacaacaatccg
gacaatcctgtcattggggtgcggtcttttggagaagcgccagagcaggtagcgcggttt
ggggaggccgccattcaaggcttgcttgcgagtggtgtcattcccgctatcaagcacttc
cctggtcatggtgatacgagcatcgattctcatgaagccgttcctgtgcttgggcatgat
cggacgcgattggatcaggtcgagttgattccattccagcgtagtattgcggcaggagtc
cccatggtgatggttggacatatcagtttgcccagcatggatgagtcaggctctcctgct
acgtattccaaggagatcgtaacgggaatattacgtgagtcactcggctttgatggggtc
gcgattacggattgcatggagatggcagctattgcgggtaccatcggggttgcagaagcg
gcggttcgtagtgtgcaggctgggatcgatctggtgctggtttcccacacgcatgaagtt
cagcaaaaaacgtacgatcgactcgttgcagccattcattcgggggagctgtcggaggag
cgggtcaacgaagctgtaaatcgcgttcttcaattaaagaaacgatttctttcctgggaa
cagtgcttgcgagcaaaaggcccttcctttgaccgtgtccagcatgcagacatggcgaaa
agtgcactcgcccaagccataaccttggtgaaaaatcaacatcagctacttcctttacag
agaagcacgcaaccgctcggtgtcatttttctggggcttgccaaccttactttggcagag
gatgggcaagcagcttctggcgatctggtcgaaccattgagaaaataccgtgaagttgaa
tactatatgatgtcgacgctcaacccgacagaggatgaaggggagatggcggcgcatgtg
atgtcagccacggagcaaatcgtcgtttttacgtacaatgcccatatctttaaaggccaa
tcgctgctggtgaatcggctcattcaacaggggaaaaaggtcgtggctgtcgccctgcga
aacccgtatgatctcttggtaatgccagaggtggatgcgtatctcgccgtttacgaccat
acgtaccaagccatagagcttgtggcaaacattttgttcggcgaacgaaaggccgctgga
catcttccggtcagcctgtttccatcggagaaaaagcagcatggtgtggggtag

DBGET integrated database retrieval system