KEGG   Brevibacillus brevis: BBR47_48930Help
Entry
BBR47_48930       CDS       T00879                                 

Gene name
mtnD
Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bbe  Brevibacillus brevis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBR47_48930 (mtnD)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BBR47_48930 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BBR47_48930 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5143667..5144179
Genome map
AA seq 170 aa AA seqDB search
MAQIRFHDNNEYISAPEEVVSFLDTQEIIYEKWGVDRLDPKHRDNYSPTDEEKQEILDTF
KPEIDAISQRRGYLTADIIVLSDKTPNLDELLVKFKGEHHHTDDECRFCVDGHGIFAIKG
KDGRYFDVELEPGDLISVPPNYRHYFTLMDDRKIKAIRLFVTPAGWEAIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaattcgttttcacgacaacaatgagtacatctccgcacccgaggaagttgtc
tccttcctggatacccaagagatcatttacgaaaaatggggcgtggatcgccttgatcca
aagcaccgtgataactacagcccgacagacgaggaaaaacaagagattctcgacaccttt
aagccagaaatcgatgcgattagccaacgtcgcggttacttgacagcggacattatcgtt
ctctctgacaaaacacctaacctcgacgagctgttggtaaaattcaagggcgagcatcac
cacaccgacgatgaatgccgcttctgcgtcgatggtcacggtattttcgccatcaaaggc
aaagacggacgctacttcgacgtcgagctggagccaggcgatctgatctccgtaccaccg
aactaccgccactacttcactctgatggacgaccgcaaaatcaaggcgattcgcctgttc
gtcactcctgcaggctgggaagcgatctattaa

DBGET integrated database retrieval system