KEGG   Brevibacillus brevis: BBR47_49560Help
Entry
BBR47_49560       CDS       T00879                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bbe  Brevibacillus brevis
Brite
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BBR47_49560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5209869..5210633
Genome map
AA seq 254 aa AA seqDB search
MRCRLLLTFSYIIWMIHQISQYLRGRDSMSGTVGCLLIHGFAGDINDILPLAKKLREAGY
QVECPTLEGHGTTRRHMAKSTRHDWLRSAEEGYKRLAMRADTIVVIGFSMGGLLAFHLTT
KYPVALLITINTPYKYWDVKEAMHYLREDFSTHSKRYIHGIGRIPISSMLQFRRLLAETK
PLLPQITTPYVLLQARRDDTVHAVSAQILATSVDESASPQITWYEHSNHMLLHGPDKEAA
IAHVMTTIKKRFPS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttgtcgcctccttctcaccttttcgtatataatatggatgattcatcaaatttcc
cagtatctgagaggaagagattccatgtcaggaacagtcggatgcttactcatccatgga
tttgccggagacatcaacgatatactcccactcgccaaaaagctccgcgaggctggctat
caggtggaatgccctaccttggagggacatgggactactcgtcgtcacatggcaaaaagc
acccgccacgactggcttcgctcggcagaagaaggctacaagcgactggccatgcgcgct
gacaccattgtggtcattggattttccatgggggggctgctcgcctttcatttaacgacg
aaataccccgtcgccctgctaattaccatcaacactccttataaatattgggatgtcaaa
gaagcgatgcactatttgcgtgaggatttctctacccactccaaacgctacatccatggc
atcggcagaatccctattagcagcatgctgcaatttcgcaggctgctggcagaaacgaag
ccgcttctgcctcagattacgaccccttacgtcctgctgcaagcaaggcgagacgatact
gtacacgccgtaagtgcccaaatactcgcaaccagtgtagacgaatctgcctccccgcaa
atcacctggtacgagcattcgaaccatatgctgctgcatggtccggacaaggaggcagcc
attgctcacgtcatgacaaccatcaagaagcgctttccatcttga

DBGET integrated database retrieval system