KEGG   Brevibacillus brevis: BBR47_50020Help
Entry
BBR47_50020       CDS       T00879                                 

Gene name
paaF
Definition
(GenBank) probable enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00071  Fatty acid degradation
bbe00280  Valine, leucine and isoleucine degradation
bbe00281  Geraniol degradation
bbe00310  Lysine degradation
bbe00360  Phenylalanine metabolism
bbe00362  Benzoate degradation
bbe00380  Tryptophan metabolism
bbe00410  beta-Alanine metabolism
bbe00627  Aminobenzoate degradation
bbe00640  Propanoate metabolism
bbe00650  Butanoate metabolism
bbe00903  Limonene and pinene degradation
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BBR47_50020 (paaF)
   00650 Butanoate metabolism
    BBR47_50020 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BBR47_50020 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBR47_50020 (paaF)
   00310 Lysine degradation
    BBR47_50020 (paaF)
   00360 Phenylalanine metabolism
    BBR47_50020 (paaF)
   00380 Tryptophan metabolism
    BBR47_50020 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBR47_50020 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBR47_50020 (paaF)
   00281 Geraniol degradation
    BBR47_50020 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBR47_50020 (paaF)
   00627 Aminobenzoate degradation
    BBR47_50020 (paaF)
   00930 Caprolactam degradation
    BBR47_50020 (paaF)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BBR47_50020 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAH45979
NITE: BBR47_50020
UniProt: C0Z573
Position
complement(5264125..5264898)
Genome map
AA seq 257 aa AA seqDB search
MAYEYISVASEDGVGIITLNRPKILNALNLQLIDELVDQLEQMDRDPDIRVIILTGNARA
FAAGADINEMVEASAIDIMKRNQFAVWDRISLISKPIIGAVSGFVLGGGCELMMNCDIVI
ASETAVIGQPEIKLGVMPGAGGTQRLTRVVGERKALEMLLTGEPISAKEALKYGLVNRVV
PVEAYYQEALKLAKQIAQQPPLAVQVIKKSVYKAGDLALQEGMDYERNSFYLLLASEDRK
EGMQAFLEKRKPRFMGH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaatatattagcgtagccagtgaagatggtgtcggtatcattacgttgaat
cggccgaagattctaaacgcgctgaatttgcagctcatcgacgaattggttgaccagctg
gagcaaatggaccgcgacccggatatacgggtgatcatcctgactggaaacgcgagggcg
ttcgcagcgggtgccgacattaatgaaatggtggaagcatcagccatcgacatcatgaag
cgcaatcagtttgcggtttgggatcgcatctcactcatctccaagccgatcattggtgcc
gtcagcggctttgtgctcggtggtggctgtgaattaatgatgaactgtgacattgtgatc
gcttcggagacagccgtcattggccaacctgaaatcaagctgggagtcatgcctggggct
ggtggtacacagcgtctgacgcgtgtggtaggtgaacgaaaagcactggagatgctgctc
acaggtgaaccgatttcggccaaagaagcgttgaaatacggattggtcaatcgggtagtg
ccagtagaagcgtactatcaggaagcgctcaagctggcgaagcaaatcgcccagcagccg
ccgctcgcggtacaggtcatcaaaaaatccgtgtacaaagctggtgatctcgctcttcaa
gagggaatggattacgagcgaaacagcttttatcttcttttggcaagcgaagatcgaaaa
gaaggcatgcaagcatttctggagaagcgcaaaccccgttttatgggacattag

DBGET integrated database retrieval system