KEGG   Brevibacillus brevis: BBR47_50020Help
Entry
BBR47_50020       CDS       T00879                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbe  Brevibacillus brevis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BBR47_50020 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BBR47_50020 (paaF)
   00650 Butanoate metabolism
    BBR47_50020 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BBR47_50020 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBR47_50020 (paaF)
   00310 Lysine degradation
    BBR47_50020 (paaF)
   00360 Phenylalanine metabolism
    BBR47_50020 (paaF)
   00380 Tryptophan metabolism
    BBR47_50020 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBR47_50020 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBR47_50020 (paaF)
   00281 Geraniol degradation
    BBR47_50020 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBR47_50020 (paaF)
   00627 Aminobenzoate degradation
    BBR47_50020 (paaF)
   00930 Caprolactam degradation
    BBR47_50020 (paaF)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BBR47_50020 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5264125..5264898)
Genome map
AA seq 257 aa AA seqDB search
MAYEYISVASEDGVGIITLNRPKILNALNLQLIDELVDQLEQMDRDPDIRVIILTGNARA
FAAGADINEMVEASAIDIMKRNQFAVWDRISLISKPIIGAVSGFVLGGGCELMMNCDIVI
ASETAVIGQPEIKLGVMPGAGGTQRLTRVVGERKALEMLLTGEPISAKEALKYGLVNRVV
PVEAYYQEALKLAKQIAQQPPLAVQVIKKSVYKAGDLALQEGMDYERNSFYLLLASEDRK
EGMQAFLEKRKPRFMGH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaatatattagcgtagccagtgaagatggtgtcggtatcattacgttgaat
cggccgaagattctaaacgcgctgaatttgcagctcatcgacgaattggttgaccagctg
gagcaaatggaccgcgacccggatatacgggtgatcatcctgactggaaacgcgagggcg
ttcgcagcgggtgccgacattaatgaaatggtggaagcatcagccatcgacatcatgaag
cgcaatcagtttgcggtttgggatcgcatctcactcatctccaagccgatcattggtgcc
gtcagcggctttgtgctcggtggtggctgtgaattaatgatgaactgtgacattgtgatc
gcttcggagacagccgtcattggccaacctgaaatcaagctgggagtcatgcctggggct
ggtggtacacagcgtctgacgcgtgtggtaggtgaacgaaaagcactggagatgctgctc
acaggtgaaccgatttcggccaaagaagcgttgaaatacggattggtcaatcgggtagtg
ccagtagaagcgtactatcaggaagcgctcaagctggcgaagcaaatcgcccagcagccg
ccgctcgcggtacaggtcatcaaaaaatccgtgtacaaagctggtgatctcgctcttcaa
gagggaatggattacgagcgaaacagcttttatcttcttttggcaagcgaagatcgaaaa
gaaggcatgcaagcatttctggagaagcgcaaaccccgttttatgggacattag

DBGET integrated database retrieval system