KEGG   Brevibacillus brevis: BBR47_51260Help
Entry
BBR47_51260       CDS       T00879                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00260  Glycine, serine and threonine metabolism
bbe00680  Methane metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
bbe01230  Biosynthesis of amino acids
Module
bbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bbe_M00002  Glycolysis, core module involving three-carbon compounds
bbe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_51260
  Energy metabolism
   00680 Methane metabolism
    BBR47_51260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBR47_51260
Enzymes [BR:bbe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBR47_51260
Membrane trafficking [BR:bbe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BBR47_51260
Exosome [BR:bbe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBR47_51260
  Exosomal proteins of melanoma cells
   BBR47_51260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF2007
Motif
Other DBs
NCBI-ProteinID: BAH46103
NITE: BBR47_51260
UniProt: C0Z5J7
Position
complement(5395898..5396470)
Genome map
AA seq 190 aa AA seqDB search
MKTYIYMVRHGESPKTEGDERTRGLTEKGRSDARIITQLLKEEGIDVFISSPYKRAVATI
EELAQSVGKEIVVFEELRELVFIGDNQIMADNELYPLVKKMFTEPDFSLPGGESITVCRN
RVVGTFRNILEQYRGQKVAIGTHGAVMTLMMGYFDSQYDLDFLLTTSKPDIYKMEFQDEV
LVETKRLWKN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctatatttacatggtcaggcacggagaatcaccaaaaaccgaaggggacgaa
agaacacgaggactgactgaaaaaggtaggtcagatgcccgtatcattactcaattgtta
aaagaagaggggatagatgtgttcatttcaagtccgtataaaagggcagtggcaaccata
gaagaactagcccagtccgtagggaaagagatcgttgtttttgaagagctgagagaactc
gtttttatcggagacaatcaaatcatggccgataacgaattgtatccattagtaaagaag
atgtttactgagccagacttttctttgcctgggggagagtcgatcaccgtttgtcggaat
cgtgtggtaggaacgttccgaaacattttagagcaatacagagggcagaaagttgcaatc
ggtacgcatggtgccgttatgacattgatgatggggtactttgacagtcagtacgacttg
gattttttattgacgacgtccaagcctgatatatacaaaatggaatttcaggatgaggta
ctcgtggaaacgaagcgattgtggaagaactga

DBGET integrated database retrieval system