KEGG   Brevibacillus brevis: BBR47_51560Help
Entry
BBR47_51560       CDS       T00879                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00020  Citrate cycle (TCA cycle)
bbe00620  Pyruvate metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
Module
bbe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_51560 (acoC)
   00020 Citrate cycle (TCA cycle)
    BBR47_51560 (acoC)
   00620 Pyruvate metabolism
    BBR47_51560 (acoC)
Enzymes [BR:bbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BBR47_51560 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N FlgT_C GCV_H
Motif
Other DBs
NCBI-ProteinID: BAH46133
NITE: BBR47_51560
UniProt: C0Z5M7
Position
complement(5433065..5434309)
Genome map
AA seq 414 aa AA seqDB search
MAVEVLMPKMGMAMKEGTVSRWNKQAGDLVSKGEVIASISSEKIEADLEAPANGVLLKIT
VSEWEGVPPGTVIGYIGHPNEQIAEETAATATFQTAALEKNLEEPVAMTESATIAASPTS
AKEVKISPVARKLAEAAGLPVESLIGTGPVGRITKEDVEKAIAEREAKQAVAAEDDRLPA
VAVEETTEQLPVTGMRKVIASRMMASLQESAQLTITTRADVTDLIALQKKMNEVTQKEHE
IKLTVTDLIARATVLALQRHKQVNSAYIDDRIHRYGHVHLGIAVALEQGLVVPVVRYAES
TSVLDLSRRIKALAAQAREGTLGMEEMQGSTFSITNLGAYGIDFFTPVLNSPEAGILGVG
AVQETPVFIGEEVQRRSILPLSLTFDHRVLDGAPAAEFLHTLRKYLEEPYRMLL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaggtgctcatgccgaagatgggaatggcgatgaaagagggaacggtttcc
cgttggaacaaacaagccggcgatctggtatccaaaggagaagtgatcgctagcatcagc
tcggaaaaaatcgaagcggacctggaagcaccggcgaacggtgttttgttgaaaatcact
gtttcggaatgggagggtgtgccacctggaacggtcattggatatatcggtcatccaaac
gagcaaatcgcggaggaaacggccgcaacggcgacgttccagacggctgctctcgagaaa
aatctggaggagcccgtggctatgacggagtcggccacgattgcggcaagtccgacgagt
gcgaaagaagtgaaaatttccccggtcgcgcgcaagttggccgaggcggccggtctcccc
gtcgaatctctcatcggcacgggaccggtgggcaggatcacaaaggaagacgtagaaaag
gcgattgctgaacgggaggcgaagcaggctgtagcagcggaggatgatcggctacctgct
gttgccgtggaggaaacgacggagcaattgcctgtcacgggcatgcggaaagtgatcgct
tcccggatgatggccagtttgcaggaaagcgcccagcttacgatcaccacacgggccgat
gtcacggatttgatcgctttgcaaaagaaaatgaacgaagtcactcaaaaagagcacgaa
atcaagctgaccgtaactgatctcatcgcgagggcgacggttctcgctctccaaaggcac
aagcaagtaaacagcgcctatatcgatgaccggattcatcggtacgggcacgtccacctg
ggaatagccgtcgcgctcgaacaagggctggtcgttccagtcgttcggtacgcagaatca
acatcggtgctggacctctcccgccggatcaaagcgctggctgcacaggcgcgggaaggg
acgcttggcatggaagagatgcaagggtctaccttctccatcacgaaccttggggcatac
ggaattgatttctttacgccagtgctgaattcgccggaggcaggcattctcggcgtaggg
gctgtgcaggaaacgcctgtcttcatcggtgaggaagtacagcggcggagcattctcccg
ctcagcctgacgttcgaccatcgggtactggacggagcaccggcagctgaatttttgcac
acgctgagaaaatacctggaagagccgtaccggatgctcttgtga

DBGET integrated database retrieval system