KEGG   Brevibacillus brevis: BBR47_52370Help
Entry
BBR47_52370       CDS       T00879                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbe  Brevibacillus brevis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBR47_52370 (tpiA)
   01230 Biosynthesis of amino acids
    BBR47_52370 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_52370 (tpiA)
   00051 Fructose and mannose metabolism
    BBR47_52370 (tpiA)
   00562 Inositol phosphate metabolism
    BBR47_52370 (tpiA)
Enzymes [BR:bbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBR47_52370 (tpiA)
Exosome [BR:bbe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBR47_52370 (tpiA)
  Exosomal proteins of bladder cancer cells
   BBR47_52370 (tpiA)
  Exosomal proteins of melanoma cells
   BBR47_52370 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5548282..5549040)
Genome map
AA seq 252 aa AA seqDB search
MRTPIIAGNWKMFKTMAEARAFAQEAKASNNTSGVQKVICAPFTALTALKEELAGTDIAI
GAQNMHFEEQGAYTGEISASMLKEIGVEYVILGHSERRQYFNETDETVNKKVVAALAAGL
VPIVCVGESLEQREAGETANVVRTQTEGAFAGVDAAQVADTVIAYEPIWAIGTGKSSTAE
DANETIAIIRSVIGERFGQATAEKVRIQYGGSVKPENIASYMAQPDIDGALVGGASLVAN
SYLQLVAGATSR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaccaattatcgcggggaactggaagatgttcaagacaatggccgaggcaaga
gcgtttgcgcaggaagccaaggcaagcaataatacttccggagtacaaaaagtcatttgc
gcaccttttacagcgttgactgcacttaaagaagagctggcgggcacggatattgccatc
ggcgcgcaaaacatgcattttgaagagcaaggtgcttatacaggcgaaatcagcgcgtcc
atgctgaaagaaattggtgtggagtacgtgattcttggtcactccgagcgccgtcaatat
ttcaatgaaacagatgagacggtgaacaaaaaggttgtagccgcattagcagcaggtctc
gtaccgattgtgtgcgtaggcgagagcctggagcagcgggaagcgggcgagacagctaac
gtagtccgtacgcagactgaaggtgcttttgctggagtagatgctgcacaagtggcggat
accgttattgcatacgagccgatctgggcgattggtacaggcaagtcttccacggcagag
gatgccaatgaaacgattgccattattcgcagcgtaatcggtgaacgcttcggacaagcg
acagccgagaaagtgcgcattcaatacggcggaagcgtaaagccggaaaacatcgcaagc
tacatggcacagcctgacattgacggagcattggtcggtggagcgagtctcgtagcgaac
agctacttgcagcttgtggcaggagcaacgtcgcgatag

DBGET integrated database retrieval system