KEGG   Brevibacillus brevis: BBR47_58090Help
Entry
BBR47_58090       CDS       T00879                                 

Definition
(GenBank) probable glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00052  Galactose metabolism
bbe00500  Starch and sucrose metabolism
bbe00520  Amino sugar and nucleotide sugar metabolism
bbe00521  Streptomycin biosynthesis
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
Module
bbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_58090
   00052 Galactose metabolism
    BBR47_58090
   00500 Starch and sucrose metabolism
    BBR47_58090
   00520 Amino sugar and nucleotide sugar metabolism
    BBR47_58090
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBR47_58090
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BBR47_58090
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBR47_58090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: BAH46786
NITE: BBR47_58090
UniProt: C0Z9T2
Position
complement(6156415..6157413)
Genome map
AA seq 332 aa AA seqDB search
MRHVIGLDVGGTTMKGAVMDENGRILLRAAKETKVHNNLPILIERMAALIKELRDQSPVP
IESVGIGFPGPFDAENGISVHSPNFQLHQADLRTPLAKLVELPLFFENDLRTAALGEATF
GAGRKVSHLIFVPLGTGVGAGIVNGGKLVRGSHGFAGEIGHVRYPGLTAPCNCGKLGCVE
TVASATGIARLARERLDKELDANPRQAKTSPLFTLCDGQLERITAEQVATAVEQGDAVAT
CAWNEACEVTGWALSVLVNVCNPQLVVIGGGVCRAGEILLAPVQASVQKYAMDVVHQQTK
IVLAELGADAGMLGAGALALQATNREQGTVKL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatgtaattggcctcgatgtcggtggtacgacaatgaaaggggcggtcatggac
gagaatgggcgaattctcctccgggctgccaaggagaccaaagtccataacaacttgccc
atcttgatcgagcgaatggctgccttgattaaagaactgcgggatcaatcacccgttccc
atagagtcagtagggatcggatttcctggtccttttgatgcggaaaatgggatatcggtt
cactcgcccaactttcaattacatcaggcagacttgcggacaccgctcgcgaagctggtg
gagctgccgcttttttttgaaaacgatttacggacagctgcgctcggagaagccacattc
ggtgcgggtcggaaggtaagtcacctcatttttgtgccgcttggtacaggggtgggggca
gggattgtaaacggaggcaagctggttcggggcagtcacggattcgcgggagagattggt
catgtgcgttatccagggcttactgctccatgcaattgcggcaagctcggttgtgtggag
acggtcgcatctgctacaggtattgccagattggcccgtgaacgcttggacaaggagctc
gatgcaaatccgcggcaagcaaaaacctctcctctgtttactttgtgcgatgggcagctt
gagcggattacggctgagcaggtggctacggcagtggaacaaggtgatgccgtagccacc
tgcgcatggaacgaagcgtgtgaagtaacgggctgggctctgtctgtgttggtgaacgtg
tgcaacccacaactggtagtgatcggcggtggcgtctgccgggctggggagattttactg
gccccggttcaagcgagtgtacaaaagtacgccatggatgtcgtacaccaacagacaaag
atcgtcttggccgagctcggtgcagatgcaggaatgctcggtgctggcgccttggccctg
caagcaacgaacagggaacaaggaaccgtgaaattgtaa

DBGET integrated database retrieval system