KEGG   Bifidobacterium bifidum BGN4: BBB_0096Help
Entry
BBB_0096          CDS       T02135                                 

Gene name
pldB
Definition
Lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBB_0096 (pldB)
Enzymes [BR:bbf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BBB_0096 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119049..120104
Genome map
AA seq 351 aa AA seqDB search
MQVKLIDENRYADEMRETVLPALATCRSEGWMAPADDDGLPPLQRAGKLHYVCYDAAKFD
RLGEDGAAATFRGAVVISHGFTEFATKYAEMVWYFLLAGYSVCVFEHRGHGYSARDVDNS
SLVWIDDWRRYVADLAKFAETVGKDYADGRPLNLYCHSMGGGIGASVLETHPTLFDKAVL
SCPMIAPVTGMPNWLASVLAGAMCRLGLGRHMVFGQSEFTPELDMADYEGASEARVRWFQ
QQRIDDPHQRTYAATFAWVRQALRLSRAVQRPEACDNVETPVLLFQAGRDVWVLNEPQNR
FAQEVNSDGGNVRVVRIENSLHEIFSMPNAVLGPYLERILGFFGSSEMPTF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgaagcttatcgacgagaaccgctatgcagacgagatgcgcgagacggtgctg
cccgcgctcgccacatgccggtccgaaggctggatggcgccggcggacgacgacggtctg
ccgccgctgcagcgtgcgggcaaactgcattacgtgtgttacgacgcggcgaaattcgac
cggttgggcgaggacggtgccgccgccacattccgcggtgccgtggtgatctcccacggg
ttcacggagttcgccacgaaatatgcggagatggtgtggtacttcctgctcgcagggtac
tcggtgtgcgtgttcgagcaccgcggacatgggtattccgcgcgtgacgtcgacaattcg
tccctagtgtggattgatgattggcggcggtatgtggccgatctggcgaaattcgcggag
acggtgggcaaggattacgcggatggccgtccgctgaacctgtactgccattcgatgggc
ggcggcatcggggcgagtgtgctggagacgcatccgacgctgttcgacaaggccgtgctg
tcgtgcccgatgatcgcgccggtgaccggtatgccgaactggctggcgtcggtgcttgcc
ggcgcgatgtgccggctcgggctgggacggcacatggtgttcgggcagagtgagttcacg
ccggagctggatatggccgattacgagggcgcgagcgaggcccgcgtgcgctggttccaa
cagcagcgcatcgacgacccgcatcagcggacgtacgcggcgacattcgcgtgggtgcgg
caggcgctgcgactgtcgcgtgccgtgcagcggccggaggcgtgcgacaatgtcgagacg
ccggtgctgctgttccaggccgggcgcgacgtgtgggtgctcaacgagccgcagaaccgg
ttcgcgcaggaggtcaactccgatggagggaatgtgcgtgtggtacgcatcgagaactcg
ctgcatgagattttcagcatgcccaatgccgttcttgggccgtatctggagcggattctg
ggcttcttcggctcatctgagatgccgacgttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system