KEGG   Bifidobacterium bifidum BGN4: BBB_0160Help
Entry
BBB_0160          CDS       T02135                                 

Gene name
bgaB
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBB_0160 (bgaB)
Enzymes [BR:bbf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBB_0160 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190263..192443
Genome map
AA seq 726 aa AA seqDB search
MRARRDFAWPKLLTADGRGIAFGGDYNPDQWPEDVWDDDIRLMTQAGVNTVALAIFSWDR
LQPTEDHWDFGWLDRIIDKLGKAGIAVDLASATATAPLWLYENHPEVLPRDKYGHPVNAG
SRQSWSPTSPVFKEYALTLCRKLAERYGANPYVTAWHMGNEYGWNNRDDYSDNALEAFRA
WCRRKYGTIDALNQAWGTTFWGQEMTGFGEVLIPRFMGADSMVNPGQKLDFERFGNDMLL
DFYKAERDAIAEICPDRPFTTNFMISTDQCCMDYAAWAEEVDFVSNDHYFHEGESHLDEL
ACSDALVDSLALGKPWYVMEHSTSAVQWKPLNTRKCKGETVRDSLAHVAMGADAINFFQW
RASAFGAEAFHSAMVPHAGEDTKLFRQVCELGATLRALADAGVQGSGLAASDTAILFSAE
SEWATRSETLPSMKLSHWHDVRDWYRAFLNAGARADIVPLAYDWSSYKTIVLPTVLILSD
ADTRRLAGFVQAGGRVVVDYATGLLDERFHTWLGGYPGAGDGLLRSMLGVRGEEFNILGA
GAEGEPNEIRLTGTGDSSTMDGAVTRLWQNDVTVAGPHVQVLATYAGEEADEWELDGTAA
LTRNAYGAGEAYFLGCDLGVSDLTRFVSGWLAVQPQSSRQPQVNSQPQSSRQPQVVGATP
DVLHTVRQSDDAIFDFYLTRGRSDVELRGIAGEPIVLFRAERGSDGGAYTVHRNGVLVVK
RPNPSL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgcgacgtgactttgcatggccgaaactgctgaccgcggacggacgcggcatc
gccttcggcggcgactacaatcccgaccaatggccggaggacgtctgggacgacgacatc
cgcctgatgacccaggccggtgtcaacaccgtggcccttgccatcttcagctgggaccgc
ctccaacccaccgaagaccattgggatttcggctggctcgatcgcatcatcgacaagctc
ggcaaggctggcatcgcggttgatttggcatccgcgacggcgaccgcacccctgtggctc
tacgaaaaccatcccgaagtccttccgcgagacaagtacggtcatccggtcaacgccggc
tcccgccagtcctggagcccgaccagcccggtgttcaaggaatacgcgctaaccctatgc
cgcaaactcgccgaacgctacggcgccaacccatatgtgacggcatggcatatgggaaac
gagtatgggtggaacaatcgcgacgactactccgacaatgcgctcgaagccttccgcgca
tggtgccgccgcaagtacggcaccatcgacgcacttaaccaggcgtggggcaccacgttc
tggggacaggagatgaccggtttcggcgaagtgctcatcccgcggttcatgggtgccgat
tccatggtcaaccccggccagaagcttgattttgaacggttcggcaatgacatgctgctc
gacttctacaaagccgaacgtgacgcgatcgccgaaatctgccccgacagacccttcacc
acgaacttcatgatctccaccgaccagtgctgtatggactacgccgcgtgggcggaggaa
gtggacttcgtatcgaacgaccactacttccacgaaggcgaatcccatctcgacgagctg
gcctgctccgacgcgctcgtggattcgctggcgctcggcaaaccgtggtacgtcatggaa
cattccacctcagcggtgcagtggaaaccgctgaacacccgcaaatgtaaaggggagacg
gtgcgcgactccctggcccacgtggccatgggcgcagacgccatcaacttcttccagtgg
cgcgcatccgcgttcggcgccgaagcgttccattccgccatggtcccgcacgccggcgag
gacacgaaactgttccgtcaggtgtgcgaattgggcgcgacgttgcgggcgctcgccgac
gccggtgttcaaggcagcggattggcggcatcggacacggcgatcctcttcagcgccgaa
tcggagtgggccacccgatccgagacattgccgagcatgaaactcagccattggcatgat
gtgcgtgactggtaccgtgcgttcctgaacgctggtgcacgcgccgacatcgtgccgctc
gcctacgactggagttcctataagaccatcgtgctgccgaccgtactgatactgagcgac
gccgatacgcggcggttggccggtttcgtacaggccggaggccgtgtggtggtcgattac
gcgaccggtctgctcgacgagcgcttccacacgtggctcggcgggtatcccggtgcgggc
gatggactgttgcgctcgatgctgggcgttcgtggtgaggaattcaacattctcggtgct
ggggcggaaggcgagccgaacgagattcggctgacgggcaccggggattcatccacgatg
gacggtgccgtgacccgcctgtggcagaacgacgtgaccgtcgccggaccgcatgtgcag
gtgcttgccacatatgccggcgaagaagcggatgagtgggagcttgatggcacggccgcg
ctcacccgcaacgcatacggcgcgggggaggcgtatttcctcggctgtgatctgggcgtg
agcgacctgacgcgattcgtgagcggctggcttgccgtgcagccgcaatcctcccgtcag
ccgcaggtcaacagtcagccgcaatccagccgtcagccgcaagtcgtcggcgcgacccct
gatgttctgcacaccgtgcgtcaatccgacgacgccatattcgacttctacctgacacgt
ggcagatcggatgtcgaactgcgtggcatcgccggggagccgatcgtcctgttccgggcg
gaacggggcagtgacggcggtgcgtatacggtgcatcgcaatggcgttctcgtggtgaaa
cgcccgaacccgtcgctgtag

DBGET integrated database retrieval system