KEGG   Bifidobacterium bifidum BGN4: BBB_0231Help
Entry
BBB_0231          CDS       T02135                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bbf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281227..282459
Genome map
AA seq 410 aa AA seqDB search
MAAAGADPRSAIAPITCDTTGTREKALASLLEQIMDSYSVSDDEKPLADAVEAFLRSKPH
LTVHRHGDTVVASTSLGRPRRVVLAGHLDTVPVIDNFPPRWLAPGDPLIREDVAAAHPGG
RVMWGRGATDMKASDAVFLYLAATLVDPQYDLTYVFYDHEEVAAEKNGLRKVAEAHPDWL
AGDFAIIGEPTDCGIEGGCNGTMRFDVVTHGVAAHSARAWMGENAIHKAADVLNRLNSYE
PRTITVDGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKTLPQAKALMMGADAG
AELGNGEHVATGGVFEGFGIEMKDESPSARPGMDAPMAVSLAKLVRERTGREPLAKLGWT
DVARFSLLGVPAVNLGAGSPLLAHKHDEQIAESELATMAGILEDWLTGRA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccggcgctgacccgcgctcggcgatcgcgccgatcacctgcgacacgacc
ggcacgcgtgagaaggcgctcgcctcactgctcgaacagatcatggactcgtattccgtc
agcgatgacgagaagccgctggccgacgccgtggaggcgttcctgcggtcgaagccgcac
ctgacggtgcacaggcacggcgacacggtggtcgcgtccacgtcgctcggcaggcctcgg
cgcgtggtgctcgccgggcaccttgacacggttccggtgatcgacaacttcccgccgcgc
tggctggcgcccggcgacccgctgatccgggaggatgtcgccgcggcgcaccccggcggg
cgggtgatgtggggccgcggcgcgaccgacatgaaggcatccgacgcggtgttcctgtac
ctcgccgccacgctggtcgacccgcaatatgacctgacgtacgtgttctacgaccatgag
gaggttgcggccgagaagaacggtctgcggaaggtggccgaggcgcatcctgattggctc
gccggcgatttcgcgatcatcggcgagccgaccgactgcggcatcgagggcggctgcaac
ggcaccatgcggttcgacgtggtcacgcacggggtcgcggcgcattcggccagggcatgg
atgggggagaacgccattcacaaggccgccgatgtcctgaaccgcctgaactcctacgag
ccgcgcaccatcacggtggatgggctggattatcgcgaggggctgaacgcgacgctgatt
tccggcggcaaggggacgaatgtcatccccgacgaatgccgtgtccatgtgaactaccgg
ttcgcgcccgacaagacgctgccgcaggcgaaggcactgatgatgggcgcggatgccggc
gcggagctcggcaatggcgagcatgtcgccaccggtggcgtgttcgagggcttcggcatc
gagatgaaggacgagtcgccgtccgcccggccgggcatggacgcgccgatggcggtgtcg
ttggcgaagctggtgcgtgagcgtacgggacgggaaccgctggcgaagctcgggtggacc
gatgtcgcgcggttctcgctgctgggtgtgcccgcggtgaacctgggcgcggggagcccg
ctgcttgcgcacaagcatgacgagcagatcgccgaaagcgagttggcgaccatggccggc
atcctggaggactggctcaccggccgcgcgtga

DBGET integrated database retrieval system