KEGG   Bifidobacterium bifidum BGN4: BBB_0789Help
Entry
BBB_0789          CDS       T02135                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BBB_0789 (pncA)
Enzymes [BR:bbf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BBB_0789 (pncA)
    3.5.1.-  
     BBB_0789 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(956067..956681)
Genome map
AA seq 204 aa AA seqDB search
MAKALIVVDVQPTFCEGGELGVEGGNAVAGRIADYVNAHRGEYAYTATTQDWHIEPGAHW
SGNPDFVDTWPKHGAAGTPNAELHPAIAVLGIAHHFKKGQYSAAYSGFEGIEDNTDRIQT
REEVTAEQSAGKTLANALKAAGVTQVDVVGIAESHCVKDTALDAKRLGFDVTVFEDLTVP
VSEELGVAARKQMADAGIILAEAR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgctgattgtggtggatgtgcagccgacattctgcgaaggcggcgagctg
ggggtcgaaggcggcaacgcggtcgccgggaggatcgccgactatgtgaacgcgcatcgc
ggcgagtatgcgtataccgccaccacgcaggattggcatatcgagccgggcgcacactgg
tcgggcaatccggatttcgtggatacgtggcccaagcatggcgcggcgggcacgccgaac
gccgagcttcatccggccatcgcggttctgggcatcgcccatcatttcaagaagggccag
tattcggcggcatactccggttttgaaggcatcgaagacaataccgaccgtatccagacg
cgcgaggaggtcacggccgaacagtccgccggcaagacgctggccaatgcgctgaaggcc
gcaggcgtcacgcaggtggatgtggtgggcatcgccgaatcgcattgcgtcaaggacacc
gcgcttgacgcgaaacgtctcggctttgatgtcaccgtgttcgaggatctgaccgttccg
gtcagcgaggagttgggtgtcgcggcccgcaaacagatggccgatgccggcatcatattg
gcggaggctcgctga

DBGET integrated database retrieval system