KEGG   Bifidobacterium bifidum BGN4: BBB_0873Help
Entry
BBB_0873          CDS       T02135                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyl transferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
bbf00240  Pyrimidine metabolism
bbf00250  Alanine, aspartate and glutamate metabolism
bbf01100  Metabolic pathways
Module
bbf_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBB_0873 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBB_0873 (pyrB)
Enzymes [BR:bbf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BBB_0873 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFL04465
UniProt: I3WHV2
Position
1066793..1067755
Genome map
AA seq 320 aa AA seqDB search
MVGQSVITLDTLSISQIRDLLHKAAYIDANRKRVAHTCDGRVLATLFYEPSTRTRLSFET
AMLRLGGQVIGFAGAQLASVSKGESIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRVTDLTIGLCGDLTFGRTVHSLIETLCRFGNVR
FVLISPDELKTPRYVIDRIKATPSCSYVEVKDLVSVIGDLDVLYMTRVQQERFFNEDDYL
RLRDTYILDEDKLSKAKPSMAVLHPLPRINEIAVEVDADPRAAYFEQVKNGMLMRMALES
SVVGDQLPGYEPLDPKEVQA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggtcggtcaaagcgtcatcacgctggatacgctttccatttcccagattcgagatttg
ctgcacaaggcggcatacatcgatgcgaaccgcaaacgcgtggcgcatacctgcgacggc
agggtgttggccacgcttttttatgagcccagcacgcgcactcgcctgagcttcgagacc
gccatgctgcggctcggcggccaggtcatcgggttcgccggcgcgcagctcgcctcggtg
tccaagggcgagtccatcgccgacacgctcaagaccgtgtccaactacgtggacgtggtc
gccatccgccacccgaaggagggagcggcgctggtcgcctcgcgcgccgcgtccgtgccc
gtgatcaacgcgggcgacggcggccacatgcaccccacgcagacgctcgccgacttggcg
acgctgcaatcgcgcttcggtcgtgtcaccgacctgaccatcggcctgtgcggcgatctg
acgttcggccgcaccgtgcattcgctgatcgagacgctgtgccgcttcggcaacgtgcgt
ttcgtgctgatcagccccgacgagctcaagaccccgcgctatgtgatcgaccgcatcaag
gcgacgccgtcctgctcctacgtggaggtcaaggacctcgtctccgtgatcggcgacctc
gacgtgctgtacatgacccgcgtgcagcaggagcgcttcttcaacgaggatgactacctg
cgtctgcgcgacacgtacatcctcgacgaggacaagctctccaaggccaagccgagcatg
gccgtgctgcacccgctgccgcgcatcaacgagatcgccgtcgaggtcgacgccgacccg
cgcgccgcctacttcgagcaggtcaagaacggcatgctcatgcgtatggcattggaaagc
tcggtggtcggagaccagctgccgggatatgagccgctcgaccccaaggaggttcaggcc
tga

DBGET integrated database retrieval system