KEGG   Bifidobacterium bifidum BGN4: BBB_0873Help
Entry
BBB_0873          CDS       T02135                                 

Gene name
pyrB
Definition
aspartate carbamoyl transferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBB_0873 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBB_0873 (pyrB)
Enzymes [BR:bbf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BBB_0873 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066793..1067755
Genome map
AA seq 320 aa AA seqDB search
MVGQSVITLDTLSISQIRDLLHKAAYIDANRKRVAHTCDGRVLATLFYEPSTRTRLSFET
AMLRLGGQVIGFAGAQLASVSKGESIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRVTDLTIGLCGDLTFGRTVHSLIETLCRFGNVR
FVLISPDELKTPRYVIDRIKATPSCSYVEVKDLVSVIGDLDVLYMTRVQQERFFNEDDYL
RLRDTYILDEDKLSKAKPSMAVLHPLPRINEIAVEVDADPRAAYFEQVKNGMLMRMALES
SVVGDQLPGYEPLDPKEVQA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggtcggtcaaagcgtcatcacgctggatacgctttccatttcccagattcgagatttg
ctgcacaaggcggcatacatcgatgcgaaccgcaaacgcgtggcgcatacctgcgacggc
agggtgttggccacgcttttttatgagcccagcacgcgcactcgcctgagcttcgagacc
gccatgctgcggctcggcggccaggtcatcgggttcgccggcgcgcagctcgcctcggtg
tccaagggcgagtccatcgccgacacgctcaagaccgtgtccaactacgtggacgtggtc
gccatccgccacccgaaggagggagcggcgctggtcgcctcgcgcgccgcgtccgtgccc
gtgatcaacgcgggcgacggcggccacatgcaccccacgcagacgctcgccgacttggcg
acgctgcaatcgcgcttcggtcgtgtcaccgacctgaccatcggcctgtgcggcgatctg
acgttcggccgcaccgtgcattcgctgatcgagacgctgtgccgcttcggcaacgtgcgt
ttcgtgctgatcagccccgacgagctcaagaccccgcgctatgtgatcgaccgcatcaag
gcgacgccgtcctgctcctacgtggaggtcaaggacctcgtctccgtgatcggcgacctc
gacgtgctgtacatgacccgcgtgcagcaggagcgcttcttcaacgaggatgactacctg
cgtctgcgcgacacgtacatcctcgacgaggacaagctctccaaggccaagccgagcatg
gccgtgctgcacccgctgccgcgcatcaacgagatcgccgtcgaggtcgacgccgacccg
cgcgccgcctacttcgagcaggtcaagaacggcatgctcatgcgtatggcattggaaagc
tcggtggtcggagaccagctgccgggatatgagccgctcgaccccaaggaggttcaggcc
tga

DBGET integrated database retrieval system