KEGG   Bifidobacterium bifidum BGN4: BBB_0904Help
Entry
BBB_0904          CDS       T02135                                 

Definition
putative UTP--glucose-1-phosphateuridylyl transferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBB_0904
   00052 Galactose metabolism
    BBB_0904
   00500 Starch and sucrose metabolism
    BBB_0904
   00520 Amino sugar and nucleotide sugar metabolism
    BBB_0904
Enzymes [BR:bbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BBB_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094503..1095969
Genome map
AA seq 488 aa AA seqDB search
MFAEDLKRTEKMTVDDVFEQSAQKMREQGMSEIAISQFRHAYHVWASEKESAWIREDAVE
PLHGVRSFHDVYKTIDHDKAVHAFAKTAFLKLNGGLGTSMGLQCAKSLLPVRRHKARQMR
FLDIILGQVLTARTRLNVPLPVTFMNSFRTSDDTMKALRHQRKFKQTDIPLEIIQHQEPK
IDAATGAPASWPTNPDLEWCPPGHGDLFSTLWESGLLDTLLEHGFEYLFISNSDNLGARP
SRTLAQYFEDTGAPFMVEVANRTYADRKGGHIVRDTATGRLILREMSQVHPDDKDAAQDI
AKHPYFNTNNIWVRIDVLRDMLAEHDGVLPLPVIINNKTVDPTDPQSPAVVQLETAMGAA
IGLFEGAICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDSYEMEDGNYIFPNVDLDPRYYK
NIEDFNERFPYNVPSLAAANSVSIKGDWTFGRDVIMFADARLEDRNEPSYVPNGEYVGPM
GIEPGDWV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgaagatctgaaacggacggagaagatgacagtggacgacgtgttcgagcag
tcggcgcagaagatgcgcgagcagggcatgagcgagatcgccatctcgcagttcaggcac
gcataccatgtgtgggccagcgagaaggagagcgcgtggatccgcgaggacgccgtcgag
ccgctgcacggcgtgcggagcttccatgacgtgtacaaaaccatcgatcatgacaaggca
gtgcacgcgttcgccaagaccgcattcctcaagctcaacggcggcctgggaacctcgatg
ggcctgcaatgcgcgaagtcgctgctgccggtgcgccgccacaaggctcggcagatgcgc
ttcctcgacatcatcctcggtcaggtgctcaccgcgcgcacgaggctgaacgtgcctctg
ccggtcacgttcatgaactcgttccgcacttcggatgacacgatgaaggcactgcgacac
cagcgcaagttcaagcagaccgacatcccgctggagatcatccagcatcaggaaccgaag
atcgacgcggccaccggggcgccggcgtcttggccgaccaaccccgatctggagtggtgc
ccgcccggccacggcgacctgttctcgacgctgtgggaatccggcctgctggacactctg
ctggagcatggcttcgaatacctgttcatctcgaactccgacaatctgggtgcgcgcccg
tctcgcacgctcgcccagtatttcgaggacacgggcgccccgttcatggtcgaggtcgcc
aatcgcacgtacgcggaccgcaagggtggccatatcgtgcgtgacacggccaccggccga
ctgatcctgcgggagatgtcgcaggtgcatcccgacgacaaggacgcggcccaggacatc
gccaagcacccgtatttcaacacgaacaacatctgggtgcgcatcgacgtgctgcgcgac
atgctcgccgagcatgacggcgtgctgccgcttcccgtcatcatcaacaacaagaccgtc
gacccgaccgacccccagtccccggcggtggtccagctggagaccgcgatgggcgcggcg
atcggcctgttcgaaggcgcgatctgtgtgcaggtggaccgcatgcggttcctgccagtg
aagacgaccaacgacctgttcattatgcgttccgatcggttccaccttacggactcgtat
gagatggaggacggcaactacattttcccgaacgtcgacctcgatccgcggtactacaag
aacatcgaggacttcaacgaacggttcccctacaacgtgccgtcgctcgccgccgcgaac
tcggtcagcatcaagggagactggacattcggacgtgacgtcatcatgttcgccgacgcg
cgtctggaggatagaaacgagcccagttacgtacccaacggcgaatacgtcggaccgatg
ggcatcgagcccggtgattgggtgtga

DBGET integrated database retrieval system